Basic Vector Information
- Vector Name:
- pLH412
- Antibiotic Resistance:
- Streptomycin
- Length:
- 6282 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Hartsough LA, Kotlajich MV, Han B, Lin C-C.J.
- Promoter:
- J23119
pLH412 vector Map
pLH412 vector Sequence
LOCUS V016314 6282 bp DNA circular SYN 27-JUL-2020 DEFINITION Exported. ACCESSION V016314 VERSION V016314 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6282) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Optogenetic control of gut bacterial metabolism JOURNAL Unpublished REFERENCE 2 (bases 1 to 6282) AUTHORS Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, Tabor JJ. TITLE Direct Submission JOURNAL Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA REFERENCE 3 (bases 1 to 6282) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., Houston, TX 77030, USA" FEATURES Location/Qualifiers source 1..6282 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..35 /label="J23119 promoter" /note="bacterial promoter (Registry of Standard Biological Parts BBa_J23119)" regulatory 52..63 /label="sRBS" /note="sRBS" /regulatory_class="ribosome_binding_site" CDS 70..789 /gene="pbsA1" /label="Heme oxygenase 1" /note="Heme oxygenase 1 from Synechocystis sp. (strain PCC 6803 / Kazusa). Accession#: P72849" regulatory 795..806 /label="RBS pprotet" /note="RBS pprotet" /regulatory_class="ribosome_binding_site" CDS 813..1559 /codon_start=1 /transl_table=11 /product="PcyA" /label="PcyA" /protein_id="QLL27767.1" /translation="MAVTDLSLTNSSLMPTLNPMIQQLALAIAASWQSLPLKPYQLPED LGYVEGRLEGEKLVIENRCYQTPQFRKMHLELAKVGKGLDILHCVMFPEPLYGLPLFGC DIVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQPEFEQQRELPPWGEIFSEYCL FIRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEAQTLEHRQGQIHYCQQQQKNDKT RRVLEKAFGEAWAERYMSQVLFDVIQ" terminator 1574..1645 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1661..1688 /label="T7Te terminator" /note="phage T7 early transcription terminator" regulatory 1740..1887 /note="specR promoter; from KD13" /regulatory_class="promoter" CDS 1888..2676 /label="SmR" /note="aminoglycoside adenylyltransferase (Murphy, 1985)" terminator 2691..2785 /label="lambda t0 terminator" /note="transcription terminator from phage lambda" rep_origin 2899..3444 /direction=RIGHT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." regulatory 3700..3734 /label="constitutive promoter J23106" /note="constitutive promoter J23106" /regulatory_class="promoter" misc_feature 3735..3769 /label="B0034" /note="B0034" CDS 3770..6031 /codon_start=1 /transl_table=11 /product="CcaS" /label="CcaS" /protein_id="QLL27768.1" /translation="MGKFLIPIEFVFLAIAMTCYLWHRQNQERRRIEISIKQQTQRERF INQITQHIRQSLNLETVLNTTVAEVKTLLQVDRVLIYRIWQDGTGSAITESVNANYPSI LGRTFSDEVFPVEYHQAYTKGKVRAINDIDQDDIEICLADFVKQFGVKSKLVVPILQHN RASSLDNESEFPYLWGLLITHQCAFTRPWQPWEVELMKQLANQVAIAIQQSELYEQLQQ LNKDLENRVEKRTQQLAATNQSLRMEISERQKTEAALRHTNHTLQSLIAASPRGIFTLN LADQIQIWNPTAERIFGWTETEIIAHPELLTSNILLEDYQQFKQKVLSGMVSPSLELKC QKKDGSWIEIVLSAAPLLDSEENIAGLVAVVADITEQKRQAEQIRLLQSVVVNTNDAVV ITEAEPIDDPGPRILYVNEAFTKITGYTAEEMLGKTPRVLQGPKTSRTELDRVRQAISQ WQSVTVEVINYRKDGSEFWVEFSLVPVANKTGFYTHWIAVQRDVTERRRTEEVRLALER EKELSRLKTRFFSMASAEFRTPLSTALAAAQLLENSEVAWLDPDKRSRNLHRIQNSVKN MVQLLDDILIINRAEAGKLEFNPNWLDLKLLFQQFIEEIQLSVSDQYYFDFICSAQDTK ALVDERLVRSILSNLLSNAIKYSPGGGQIKIALSLDSEQIIFEVTDQGIGISPEDQKQI FEPFHRGKNVRNITGTGLGLMVAKKCVDLHSGSILLKSAVDQGTTVTICLKRYNHLPRA " misc_feature 5369..5371 /label="H534A" /note="H534A" terminator complement(6055..6098) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.