Basic Vector Information
- Vector Name:
- pMT444
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5943 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Taketani M, Zhang J, Zhang S, Triassi AJ
pMT444 vector Map
pMT444 vector Sequence
LOCUS 62056_17475 5943 bp DNA circular SYN 19-MAY-2020 DEFINITION Cloning vector pMT444, complete sequence. ACCESSION MN991276 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5943) AUTHORS Taketani M, Zhang J, Zhang S, Triassi AJ, Huang YJ, Griffith LG, Voigt CA. TITLE Genetic circuit design automation for the gut resident species Bacteroides thetaiotaomicron JOURNAL Nat. Biotechnol. (2020) In press PUBMED 32231334 REFERENCE 2 (bases 1 to 5943) AUTHORS Taketani M, Voigt CA. TITLE Direct Submission JOURNAL Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5943) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA" FEATURES Location/Qualifiers source 1..5943 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(156..890) /codon_start=1 /transl_table=11 /product="ErmG" /label=ErmG /protein_id="QJT41644.1" /translation="MNKVNIKDSQNFITSKYHIEKIMNCISLDEKDNIFEIGAGKGHFT AGLVKRCNFVTAIEIDSKLCEVTRNKLLNYPNYQIVNDDILKFTFPSHNPYKIFGSIPY NISTNIIRKIVFESSATISYLIVEYGFAKMLLDTNRSLALLLMAEVDISILAKIPRYYF HPKPKVDSTLIVLKRKPAKMAFKERKKYETFVMKWVNKEYEKLFTKNQFNKALKHARIY DINNISFEQFVSLFNSYKIFNG" CDS 1378..2235 /label=AmpR /note="beta-lactamase" oriT complement(2369..2478) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 2649..3037 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 3078..3107 /label=tL17 /note="tL17" /regulatory_class="terminator" regulatory 3123..3130 /label=L3S3P21 /note="L3S3P21" /regulatory_class="terminator" protein_bind 3183..3199 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." protein_bind 3216..3232 /label=lac repressor encoded by lacI binding site /bound_moiety="lac repressor encoded by lacI" misc_RNA 3278..3328 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 3352..3394 /label=rpiL* /note="rpiL*" /regulatory_class="terminator" CDS 3395..3907 /label=Nluc /note="NanoLuc(R) luciferase" regulatory 3927..3987 /label=L3S2P21 /note="L3S2P21" /regulatory_class="terminator" primer_bind complement(4113..4133) /label=pNBU1_seq.REV /note="pNBU1_seq.REV" misc_recomb 4231..4560 /label=attN1 region /note="attN1 region" misc_feature 4358..4371 /label=CC Region /note="CC Region" misc_difference 4370 /replace="g" /label=mutated for higher integration efficiency /note="mutated for higher integration efficiency" CDS 4576..5913 /codon_start=1 /transl_table=11 /product="IntN1" /label=IntN1 /note="NBU1 integrase" /protein_id="QJT41647.1" /translation="MKVTFIIKKAAKRYDTESMATIYVRFRNGRQLDSVAPTQLAINPN LWDDKDECVKTKAVCNEEMRTHINEEIRQLKTYIEKVYQQEKEAIDKEWLKTTLDKFYH PEKYFLPEEVVIKPTIGELFDEFLNKHPLSEVRKKNFRVVKRALLRYELYVRATKRGQK GFILDVDLVTPDTLRDMWDFFQNEYQYYELYPSIYEAIPEKRTPQPRSKNTLIDCFSRI RTFFLWCFDNKRTTNRPFDKFPIEECTYGTPYYITLEERDRIFNADLSATPQLAIQRDI FIFQTLIGCRVSDLYRMTKLNVVNEAIEYIPKKTKEGNPVTVRVPLNDKAKEILERYKE YEGKLLPFISEQKYNDAIKKIFKLAGVDRIVTILDPLTHNEIKRPIYEVASSHLARRTF IGNIYKKVKDPNLVSALSGHKEGSKAFRRYRDIDEEMKKDLVKLLD"
This page is informational only.