Basic Vector Information
- Vector Name:
- pLM161-Venus
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5277 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Emrich-Mills TZ, Yates G, Barrett J, Grouneva I
pLM161-Venus vector Map
pLM161-Venus vector Sequence
LOCUS 62056_14340 5277 bp DNA circular SYN 28-MAR-2021 DEFINITION Cloning vector pLM161-Venus, complete sequence. ACCESSION MT737962 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5277) AUTHORS Emrich-Mills TZ, Yates G, Barrett J, Grouneva I, Lau CS, Walker CE, Kwok TK, Davey JW, Johnson MP, Mackinder LCM. TITLE Direct Submission JOURNAL Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom REFERENCE 2 (bases 1 to 5277) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (08-JUL-2020) Molecular Biology and Biotechnology, University of Sheffield, Western Bank, Sheffield, South Yorkshire S10 2TN, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5277 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 28..744 /label=Venus /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" CDS 796..819 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS join(1562..1648,1794..2705) /codon_start=1 /transl_table=11 /product="APHVII" /label=APHVII /note="hygromycin resistance marker" /protein_id="QTE34484.1" /translation="MTQESLLLLDRIDSDDSYASLRNDQEFWEPLARRALEELGLPVPP VLRVPGESTNPVLVGEPGPVIKLFGEHWCGPESLASESEAYAVLADAPVPVPRLLGRGE LRPGTGAWPWPYLVMSRMTGTTWRSAMDGTTDRNALLALARELGRVLGRLHRVPLTGNT VLTPHSEVFPELLRERRAATVEDHRGWGYLSPRLLDRLEDWLPDVDTLLAGREPRFVHG DLHGTNIFVDLAATEVTGIVDFTDVYAGDSRYSLVQLHLNAFRGDREILAALLDGAQWK RTEDFARELLAFTFLHDFEVFEETPLDLSGFTDPEELAQFLWGPPDTAPGA" rep_origin 3014..3559 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(3658..4470) /label=KanR /note="aminoglycoside phosphotransferase" CDS 4920..5222 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase"
This page is informational only.