pCH8 vector (V016292)

LOCUS       V016292                 6490 bp    DNA     circular SYN 01-FEB-2022
DEFINITION  Exported.
ACCESSION   V016292
VERSION     V016292
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6490)
  AUTHORS   Ruf S, Forner J, Hasse C, Kroop X, Seeger S, Schollbach L, Schadach
            A, Bock R.
  TITLE     High-efficiency generation of fertile transplastomic Arabidopsis
            plants
  JOURNAL   Nat Plants 5 (3), 282-289 (2019)
   PUBMED   30778165
REFERENCE   2  (bases 1 to 6490)
  AUTHORS   Forner J, Hasse C, Ruf S, Bock R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUL-2018) Organelle Biology, Biotechnology and
            Molecular Ecophysiology, Max Planck Institute of Molecular Plant
            Physiology, Am Muehlenberg 1, Potsdam, Brandenburg D-14476, Germany
REFERENCE   3  (bases 1 to 6490)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Nat
            Plants"; date: "2019"; volume: "5"; issue: "3"; pages: "282-289"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (06-JUL-2018) Organelle Biology, Biotechnology and Molecular
            Ecophysiology, Max Planck Institute of Molecular Plant Physiology,
            Am Muehlenberg 1, Potsdam, Brandenburg D-14476, Germany"
FEATURES             Location/Qualifiers
     source          1..6490
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     gene            1..521
                     /gene="psaB"
                     /label="psaB"
     CDS             1..521
                     /codon_start=3
                     /transl_table=11
                     /gene="psaB"
                     /product="PSAB"
                     /label="psaB"
                     /protein_id="QBG49732.1"
                     /translation="GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVS
                     QFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLIS
                     WRGYWQELIETLAWAHERTPLANLIRWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFL
                     IASTSGKFG"
     CDS             656..955
                     /gene="rps14"
                     /label="Small ribosomal subunit protein uS14c"
                     /note="Small ribosomal subunit protein uS14c from
                     Arabidopsis thaliana. Accession#: P56804"
     tRNA            1119..1192
                     /product="tRNA-Met"
                     /label="trnfM"
                     /note="trnfM"
     regulatory      1302..1451
                     /label="Zea mays clpP promoter"
                     /note="Zea mays clpP promoter"
                     /regulatory_class="promoter"
     CDS             1453..2241
                     /label="SmR"
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     regulatory      2252..2401
                     /label="Nicotiana tabacum rps16 terminator"
                     /note="Nicotiana tabacum rps16 terminator"
                     /regulatory_class="terminator"
     primer_bind     complement(2417..2433)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     tRNA            complement(2493..2563)
                     /product="tRNA-Gly"
     CDS             complement(3117..3302)
                     /gene="psbZ"
                     /label="Photosystem II reaction center protein Z"
                     /note="Photosystem II reaction center protein Z from
                     Nicotiana tabacum. Accession#: P09974"
     promoter        complement(3641..3659)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3669..3685)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      3827..4282
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4308..4412
                     /label="AmpR promoter"
     CDS             4413..5270
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      5444..6032
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    6320..6341
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        6356..6386
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    6394..6410
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     6418..6434
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        6455..6473
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"