Basic Vector Information
- Vector Name:
- pTRV-RNA2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8928 bp
- Type:
- VIGS vector
- Replication origin:
- ori
- Source/Author:
- Rahman J, Baldwin IT, Gase K.
pTRV-RNA2 vector Map
pTRV-RNA2 vector Sequence
LOCUS 62056_21570 8928 bp DNA circular SYN 23-NOV-2021 DEFINITION VIGS vector pTRV-RNA2, complete sequence. ACCESSION MH625696 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8928) AUTHORS Rahman J, Baldwin IT, Gase K. TITLE California TRV-based VIGS vectors mediate gene silencing at elevated temperatures but with greater growth stunting JOURNAL BMC Plant Biol 21, 553 (2021) REFERENCE 2 (bases 1 to 8928) AUTHORS Rahman J, Gase K, Baldwin IT. TITLE Direct Submission JOURNAL Submitted (13-JUL-2018) Molecular Ecology, Max-Planck-Institute for Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany REFERENCE 3 (bases 1 to 8928) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Plant Biol 21, 553 (2021)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JUL-2018) Molecular Ecology, Max-Planck-Institute for Chemical Ecology, Hans-Knoell-Strasse 8, Jena, Thueringen 07745, Germany" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8928 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 201..546 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" misc_feature 568..1728 /note="Tobacco rattle virus California isolate segment RNA2" CDS 1090..1692 /codon_start=1 /transl_table=11 /product="coat protein" /label=coat protein /protein_id="QDJ00478.1" /translation="MTDGMYDEEFDSKALNETFSPWVEEKNWKDVLMRLSAMKFALQAD RDKIPGVLSDLRKDCPFSAFKRFPDKEMWSKLTKEAVIALAQIQAASSFKRRADEKNAV SGLITATPAQASTSNANPSGSATTVVRPPRLDDSSFQEDSFSFGKFDDASTAYHKALSY LEGLNLKPLYRRQFEKSYNTRWVPAAAPVAPGPRPNP" misc_feature 1729..1759 /label=polylinker /note="polylinker" misc_feature 1760..2327 /note="Tobacco rattle virus California isolate segment RNA2" polyA_signal 2337..2511 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" misc_feature complement(2594..2618) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS complement(2871..3662) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS 5072..5698 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 6130..7200 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 7269..7463 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin complement(7906..8494) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8851..8875) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.