Basic Vector Information
- Vector Name:
- pET24a-G3-pM421-468-ELP_KV8F-79
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6644 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim H, Gaynor AS, Chen W.
pET24a-G3-pM421-468-ELP_KV8F-79 vector Map
pET24a-G3-pM421-468-ELP_KV8F-79 vector Sequence
LOCUS 62056_9845 6644 bp DNA circular SYN 22-JUL-2019 DEFINITION Cloning vector pET24a-G3-pM421-468-ELP_KV8F-79, complete sequence. ACCESSION MN082628 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6644) AUTHORS Kim H, Gaynor AS, Chen W. TITLE Direct Submission JOURNAL Submitted (19-JUN-2019) Chemical and Biochemical Engineering, University of Delaware, 150 Academy Street, Colburn Lab, Newark, DE 19716, USA REFERENCE 2 (bases 1 to 6644) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (19-JUN-2019) Chemical and Biochemical Engineering, University of Delaware, 150 Academy Street, Colburn Lab, Newark, DE 19716, USA" FEATURES Location/Qualifiers source 1..6644 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(563..1375) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 1497..2085 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2271..2413) /label=bom /note="basis of mobility region from pBR322" CDS complement(2518..2706) /label=rop /note="Rop protein, which maintains plasmids at low copy number" protein_bind complement(3481..3502) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3518..4597) /label=lacI /note="lac repressor" promoter complement(4598..4675) /label=lacI promoter promoter 4984..5002 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5003..5027 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5042..5064 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 5072..6478 /codon_start=1 /transl_table=11 /product="G3-pM421-468-ELP_KV8F-79" /label=G3-pM421-468-ELP_KV8F-79 /protein_id="QDM54905.1" /translation="MGGGLNLHLEEAYREGDNTYYRVNENYYPGASIYENERASRDSEF QNEILKRELRRQACGRSKGPGVGVPGKGVPGVGVPGVGVPGVGVPGVGVPGFGVPGVGV PGVGVPGVGVPGVGVPGKGVPGVGVPGVGVPGVGVPGVGVPGFGVPGVGVPGVGVPGVG VPGVGVPGKGVPGVGVPGVGVPGVGVPGVGVPGFGVPGVGVPGVGVPGVGVPGVGVPGK GVPGVGVPGVGVPGVGVPGVGVPGFGVPGVGVPGVGVPGVGVPGVGVPGKGVPGVGVPG VGVPGVGVPGVGVPGFGVPGVGVPGVGVPGVGVPGVGVPGKGVPGVGVPGVGVPGVGVP GVGVPGFGVPGVGVPGVGVPGVGVPGVGVPGKGVPGVGVPGVGVPGVGVPGVGVPGFGV PGVGVPGVGVPGVGVPGVGVPGKGVPGVGVPGVGVPGVGVPGVGVPGFGVPGVGVPGVG VPGVGVPGWP" CDS 6488..6505 /label=6xHis /note="6xHis affinity tag" terminator 6572..6619 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.