Basic Vector Information
- Vector Name:
- pTestOR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2923 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Becker K, Meyer A, Roberts TM, Panke S.
pTestOR vector Map
pTestOR vector Sequence
LOCUS 62056_21135 2923 bp DNA circular SYN 28-JUL-2021 DEFINITION Cloning vector pTestOR, complete sequence. ACCESSION MZ395127 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2923) AUTHORS Becker K, Meyer A, Roberts TM, Panke S. TITLE Plasmid replication based on the T7 origin of replication requires a T7 RNAP variant and inactivation of ribonuclease H JOURNAL Nucleic Acids Res (2021) In press PUBMED 34255845 REFERENCE 2 (bases 1 to 2923) AUTHORS Becker K. TITLE Direct Submission JOURNAL Submitted (10-JUN-2021) D-BSSE, ETHZ, Mattenstrasse 26, Basel, BS 4058, Switzerland REFERENCE 3 (bases 1 to 2923) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-JUN-2021) D-BSSE, ETHZ, Mattenstrasse 26, Basel, BS 4058, Switzerland" FEATURES Location/Qualifiers source 1..2923 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 240..462 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" promoter complement(1422..1440) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1596..1612) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(2059..2715) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(2716..2818) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.