Basic Vector Information
- Vector Name:
- pNATX13-matF
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6099 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Chi Z, Chi Z, Kong C.
pNATX13-matF vector Map
pNATX13-matF vector Sequence
LOCUS 62056_17730 6099 bp RNA circular SYN 30-AUG-2020 DEFINITION Shuttle vector pNATX13-matF, complete sequence. ACCESSION MT881546 VERSION . KEYWORDS . SOURCE ORGANISM REFERENCE 1 (bases 1 to 6099) AUTHORS Chi Z, Chi Z, Kong C. TITLE Direct Submission JOURNAL Submitted (30-JUL-2020) Ocean University of China, Qing Dao, Shandong 266000, China REFERENCE 2 (bases 1 to 6099) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (30-JUL-2020) Ocean University of China, Qing Dao, Shandong 266000, China" FEATURES Location/Qualifiers source 1..6099 /mol_type="other DNA" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" gene 3101..3811 /gene="matF" /label=matF CDS 3101..3811 /codon_start=1 /transl_table=11 /gene="matF" /product="piperazate synthase" /label=matF /protein_id="QNJ99252.1" /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH GPRDNRERYYRVSFREVPTRNHTRRSPTGGVVSTEPVVVMDTILVVRPRQVQFKWSFDK VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFI KISDSCPAKPPSAD" protein_bind complement(3818..3851) /label=lox71 /note="Left element (LE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." polyA_signal complement(3862..4036) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(4080..4646) /label=NrsR /note="nourseothricin acetyltransferase" protein_bind complement(5093..5126) /label=lox66 /note="Right element (RE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(5705..5721) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.