Basic Vector Information
- Vector Name:
- pLeo1261
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5818 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Scheller L, Schmollack M, Bertschi A, Mansouri M
pLeo1261 vector Map
pLeo1261 vector Sequence
LOCUS 62056_14025 5818 bp DNA circular SYN 30-JUN-2020 DEFINITION Cloning vector pLeo1261, complete sequence. ACCESSION MT267314 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5818) AUTHORS Scheller L, Schmollack M, Bertschi A, Mansouri M, Saxena P, Fussenegger M. TITLE Phosphoregulated orthogonal signal transduction in mammalian cells JOURNAL Nat Commun 11 (1), 3085 (2020) PUBMED 32555187 REFERENCE 2 (bases 1 to 5818) AUTHORS Scheller L. TITLE Direct Submission JOURNAL Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland REFERENCE 3 (bases 1 to 5818) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2020"; volume: "11"; issue: "1"; pages: "3085" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAR-2020) STI IBI-STI LPDI, EPFL, AI 3123 (Batiment AI), Station 19, Lausanne 1015, Switzerland" FEATURES Location/Qualifiers source 1..5818 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(64..80) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(88..104) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(112..142) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(157..178) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(466..1051) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1225..2082) /label=AmpR /note="beta-lactamase" promoter complement(2083..2187) /label=AmpR promoter misc_feature 2238 /label=Promoter Region /note="Promoter Region" misc_feature 2256..2459 /label=SV40 early promoter /note="SV40 early promoter" promoter 2509..2527 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 2559..3599 /codon_start=1 /transl_table=11 /product="C-ORK" /label=C-ORK /protein_id="QKE44353.1" /translation="MTSYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYILKTANNY QEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSESQLPDSGSEDQVATLITTLG NLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSE RGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGERSNRASASGGGGSASGSQV QLVESGGGLVQAGGSLRLSCTASGRTGTIYSMAWFRQAPGKEREFLATVGWSSGITYYM DSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCTATRAYSVGYDYWGQGTQVTVSSA SGSTGV" misc_feature 2568..2585 /label=alpha helix /note="alpha helix" misc_feature 2586..3176 /label=Kinase domain 346-538 /note="Kinase domain 346-538" misc_feature 3177..3179 /label=DucS cytoplasmatic kinase domain /note="DucS cytoplasmatic kinase domain" misc_feature 3207..3575 /label=aCaffVHH /note="aCaffVHH" misc_feature 3294..3317 /label=CDR1 /note="CDR1" misc_feature 3366..3389 /label=CDR2 /note="CDR2" misc_feature 3507..3542 /label=CDR3 /note="CDR3" polyA_signal 3636..3860 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 3906..4334 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4348..4677 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4744..5535 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 5712..5818 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.