pDCpOE-L-RP10- vector (V016221)

LOCUS       V016221                 8715 bp    DNA     circular SYN 09-MAR-2020
DEFINITION  Exported.
ACCESSION   V016221
VERSION     V016221
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8715)
  AUTHORS   Nemeth T, Papp C, Szenzenstein J, Gacser A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) Department of Microbiology, University of
            Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary
REFERENCE   2  (bases 1 to 8715)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. v11
            Sequencing Technology :: IonTorrent
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
            (27-NOV-2019) Department of Microbiology, University of Szeged,
            Kozep fasor 52, Szeged, Csongrad 6726, Hungary"
FEATURES             Location/Qualifiers
     source          1..8715
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        24..128
                     /label="AmpR promoter"
     CDS             129..986
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      1160..1748
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    2036..2057
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2072..2102
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    2110..2126
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2134..2150
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        2171..2189
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     regulatory      2222..3071
                     /label="Candida albicans TDH3 promoter"
                     /note="Candida albicans TDH3 promoter"
                     /regulatory_class="promoter"
     protein_bind    3078..3202
                     /label="attR1"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        3227..3257
                     /label="lac UV5 promoter"
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             3311..3967
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     CDS             4312..4614
                     /label="ccdB"
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(4658..4782)
                     /label="attR2"
                     /note="recombination site for the Gateway(R) LR reaction"
     gene            5064..5840
                     /gene="CPAR2_110290"
                     /label="CPAR2_110290"
     CDS             5064..5840
                     /codon_start=1
                     /transl_table=11
                     /gene="CPAR2_110290"
                     /product="RPS1-like protein"
                     /label="CPAR2_110290"
                     /note="similar to Candida albicans RPS1; recombination
                     target"
                     /protein_id="QID92265.1"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKDWFDIKAPTTFENRNVGK
                     TLINRSTGLKNAADGLKGRVFEVCLADLQGSEDHSYRKIKLRVDEVQGKNLLTNFHGLD
                     FTSDKIRSRPLVRKWQSLVEANVTVKTADDYVLRVFAIAFTKRQPNQIKKTTYAQSSKL
                     REIRKKMTEIMQREVSNCTLAQLTSKLIPEVIGREIEKSTQTIFPLQNVHIRKVKLLKQ
                     PKFDLGSLLALHGEGSTEEKGKKVSGGFKDVVLESV"
     misc_feature    5400..5405
                     /gene="CPAR2_110290"
                     /label="StuI site for plasmid linearization"
                     /note="StuI site for plasmid linearization"
     CDS             complement(6068..7186)
                     /gene="LEU2"
                     /label="3-isopropylmalate dehydrogenase"
                     /note="3-isopropylmalate dehydrogenase from Candida
                     maltosa. Accession#: P07139"
     regulatory      complement(7187..8061)
                     /label="Candida maltosa LEU2 promoter"
                     /note="Candida maltosa LEU2 promoter"
                     /regulatory_class="promoter"
     promoter        complement(8076..8094)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(8101..8117)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      complement(8258..8713)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"