Basic Vector Information
- Vector Name:
- pET22b-SHP2-N-laterosporulin
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5961 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Salehzadeh S, Tabatabaei M, Derakhshandeh A, Karbalaei-Heidari HR
pET22b-SHP2-N-laterosporulin vector Map
pET22b-SHP2-N-laterosporulin vector Sequence
LOCUS 62056_9805 5961 bp DNA circular SYN 20-JUL-2021 DEFINITION Expression vector pET22b-SHP2-N-laterosporulin, complete sequence. ACCESSION MZ496307 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5961) AUTHORS Salehzadeh S, Tabatabaei M, Derakhshandeh A, Karbalaei-Heidari HR, Kazemipour N. TITLE Expression Vector pET22b-SHP2-N-laterosporulin sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 5961) AUTHORS Salehzadeh S, Tabatabaei M, Derakhshandeh A, Karbalaei-Heidari HR, Kazemipour N. TITLE Direct Submission JOURNAL Submitted (02-JUL-2021) Department of Biology, Shiraz University, Addabiat Cross, Shiraz, Fars 71454, Iran REFERENCE 3 (bases 1 to 5961) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-JUL-2021) Department of Biology, Shiraz University, Addabiat Cross, Shiraz, Fars 71454, Iran" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5961 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 494..598 /label=AmpR promoter CDS 599..1456 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1630..2218 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2404..2546) /label=bom /note="basis of mobility region from pBR322" CDS complement(2651..2839) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(3614..3635) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3651..4730) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4731..4808) /label=lacI promoter promoter 5117..5135 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5136..5160 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5175..5197 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" sig_peptide 5205..5270 /label=pelB signal sequence /note="leader peptide for secretion" CDS 5274..5291 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 5622..5636 /codon_start=1 /label=enterokinase site /note="enterokinase recognition and cleavage site" /translation="DDDDK" CDS 5805..5822 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 5889..5936 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.