Basic Vector Information
- Vector Name:
- pMT406
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6083 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Taketani M, Zhang J, Zhang S, Triassi AJ
pMT406 vector Map
pMT406 vector Sequence
LOCUS 62056_17470 6083 bp DNA circular SYN 19-MAY-2020 DEFINITION Cloning vector pMT406, complete sequence. ACCESSION MN991274 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6083) AUTHORS Taketani M, Zhang J, Zhang S, Triassi AJ, Huang YJ, Griffith LG, Voigt CA. TITLE Genetic circuit design automation for the gut resident species Bacteroides thetaiotaomicron JOURNAL Nat. Biotechnol. (2020) In press PUBMED 32231334 REFERENCE 2 (bases 1 to 6083) AUTHORS Taketani M, Voigt CA. TITLE Direct Submission JOURNAL Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 6083) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA" FEATURES Location/Qualifiers source 1..6083 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(156..890) /codon_start=1 /transl_table=11 /product="ErmG" /label=ErmG /protein_id="QJT41634.1" /translation="MNKVNIKDSQNFITSKYHIEKIMNCISLDEKDNIFEIGAGKGHFT AGLVKRCNFVTAIEIDSKLCEVTRNKLLNYPNYQIVNDDILKFTFPSHNPYKIFGSIPY NISTNIIRKIVFESSATISYLIVEYGFAKMLLDTNRSLALLLMAEVDISILAKIPRYYF HPKPKVDSTLIVLKRKPAKMAFKERKKYETFVMKWVNKEYEKLFTKNQFNKALKHARIY DINNISFEQFVSLFNSYKIFNG" CDS 1378..2235 /label=AmpR /note="beta-lactamase" oriT complement(2369..2478) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 2649..3037 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 3078..3107 /label=tL17 /note="tL17" /regulatory_class="terminator" misc_feature 3134..3416 /label=PAM3 /note="PAM3" regulatory 3377..3380 /label=-33 sigma factor recognitions site /note="-33 sigma factor recognitions site" /regulatory_class="other" regulatory 3403..3410 /label=-7 sigma factor recognitions site /note="-7 sigma factor recognitions site" /regulatory_class="other" regulatory 3417 /label=BT1311 /note="BT1311" /regulatory_class="ribosome_binding_site" misc_RNA 3418..3468 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 3492..3534 /label=rpiL* /note="rpiL*" /regulatory_class="terminator" CDS 3535..4047 /label=Nluc /note="NanoLuc(R) luciferase" regulatory 4067..4127 /label=L3S2P21 /note="L3S2P21" /regulatory_class="terminator" primer_bind complement(4253..4273) /label=pNBU1_seq.REV /note="pNBU1_seq.REV" misc_recomb 4371..4700 /label=attN1 region /note="attN1 region" misc_feature 4498..4511 /label=CC Region /note="CC Region" misc_difference 4510 /replace="g" /label=mutated for higher integration efficiency /note="mutated for higher integration efficiency" CDS 4716..6053 /codon_start=1 /transl_table=11 /product="IntN1" /label=IntN1 /note="NBU1 integrase" /protein_id="QJT41637.1" /translation="MKVTFIIKKAAKRYDTESMATIYVRFRNGRQLDSVAPTQLAINPN LWDDKDECVKTKAVCNEEMRTHINEEIRQLKTYIEKVYQQEKEAIDKEWLKTTLDKFYH PEKYFLPEEVVIKPTIGELFDEFLNKHPLSEVRKKNFRVVKRALLRYELYVRATKRGQK GFILDVDLVTPDTLRDMWDFFQNEYQYYELYPSIYEAIPEKRTPQPRSKNTLIDCFSRI RTFFLWCFDNKRTTNRPFDKFPIEECTYGTPYYITLEERDRIFNADLSATPQLAIQRDI FIFQTLIGCRVSDLYRMTKLNVVNEAIEYIPKKTKEGNPVTVRVPLNDKAKEILERYKE YEGKLLPFISEQKYNDAIKKIFKLAGVDRIVTILDPLTHNEIKRPIYEVASSHLARRTF IGNIYKKVKDPNLVSALSGHKEGSKAFRRYRDIDEEMKKDLVKLLD"
This page is informational only.