Basic Vector Information
- Vector Name:
- pEM018
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8545 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mancera E, Frazer C, Porman AM, Ruiz-Castro S
pEM018 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEM018 vector Sequence
LOCUS 62056_9165 8545 bp DNA circular SYN 14-APR-2019 DEFINITION Cloning vector pEM018, complete sequence. ACCESSION MK431396 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8545) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz-Castro S, Johnson AD, Bennett RJ. TITLE Genetic Modification of Closely Related Candida Species JOURNAL Front Microbiol 10, 357 (2019) PUBMED 30941104 REFERENCE 2 (bases 1 to 8545) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz S, Johnson AD, Bennett RJ. TITLE Direct Submission JOURNAL Submitted (23-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico REFERENCE 3 (bases 1 to 8545) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Microbiol 10, 357 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico" FEATURES Location/Qualifiers source 1..8545 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 79..108 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" misc_recomb 623..656 /label=FLP recombination target sequence (FRT) /note="FLP recombination target sequence (FRT)" misc_feature 663..1649 /label=promoter region from Candida tropicalis PCK1 /note="promoter region from Candida tropicalis PCK1" CDS 1650..2918 /label=FLP /note="site-specific recombinase" misc_feature 2922..3309 /label=terminator region from Candida albicans ACT1 /note="terminator region from Candida albicans ACT1" misc_feature 3316..3813 /label=promoter region from Candida albicans ACT1 /note="promoter region from Candida albicans ACT1" gene 3814..5040 /gene="SAT1" /label=SAT1 CDS join(3814..3823,4478..5040) /codon_start=1 /transl_table=11 /gene="SAT1" /product="streptomycin acetyltransferase" /label=SAT1 /note="nourseothricin resistance marker" /protein_id="QBY25792.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" misc_feature 5044..5173 /label=terminator region from Candida albicans URA3 /note="terminator region from Candida albicans URA3" protein_bind complement(5178..5211) /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" primer_bind complement(5213..5229) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(5266..5284) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5305..5321) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5329..5345) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5353..5383) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5398..5419) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5707..6295) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 6515..6617 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 6618..7274 /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(7765..7870) /label=AmpR promoter rep_origin 7897..8352 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 8493..8509 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 8519..8537 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.