Basic Vector Information
- Vector Name:
- pLT_181
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3427 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Tian L, Conway PM, Cervenka ND, Cui J
- Promoter:
- rhaB
pLT_181 vector Map
pLT_181 vector Sequence
LOCUS 62056_14455 3427 bp DNA circular SYN 27-AUG-2019 DEFINITION Expression vector pLT_181, complete sequence. ACCESSION MK542531 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3427) AUTHORS Tian L, Conway PM, Cervenka ND, Cui J, Maloney M, Olson DG, Lynd LR. TITLE Metabolic engineering of Clostridium thermocellum for n-butanol production from cellulose JOURNAL Biotechnol Biofuels 12, 186 (2019) PUBMED 31367231 REFERENCE 2 (bases 1 to 3427) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (18-FEB-2019) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, New Hampshire 03755, United States REFERENCE 3 (bases 1 to 3427) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels 12, 186 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-FEB-2019) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, New Hampshire 03755, United States" FEATURES Location/Qualifiers source 1..3427 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 39..627 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(759..786) /label=T7Te terminator /note="phage T7 early transcription terminator" CDS complement(813..1619) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(1620..1710) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" promoter 1814..1932 /label=rhaB promoter /note="promoter of the E. coli rhaBAD operon, conferring tight induction with L-rhamnose and repression with D-glucose in the presence of RhaR and RhaS (Giacalone et al., 2006)" CDS 3144..3161 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 3195..3242 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" terminator 3340..3369 /label=T3Te terminator /note="phage T3 early transcription terminator"
This page is informational only.