Basic Vector Information
- Vector Name:
- pEGC
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5829 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Becker K, Meyer A, Roberts TM, Panke S.
pEGC vector Vector Map
pEGC vector Sequence
LOCUS 62056_8945 5829 bp DNA circular SYN 28-JUL-2021 DEFINITION Cloning vector pEGC, complete sequence. ACCESSION MZ395121 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5829) AUTHORS Becker K, Meyer A, Roberts TM, Panke S. TITLE Plasmid replication based on the T7 origin of replication requires a T7 RNAP variant and inactivation of ribonuclease H JOURNAL Nucleic Acids Res (2021) In press PUBMED 34255845 REFERENCE 2 (bases 1 to 5829) AUTHORS Becker K. TITLE Direct Submission JOURNAL Submitted (10-JUN-2021) D-BSSE, ETHZ, Mattenstrasse 26, Basel, BS 4058, Switzerland REFERENCE 3 (bases 1 to 5829) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-JUN-2021) D-BSSE, ETHZ, Mattenstrasse 26, Basel, BS 4058, Switzerland" FEATURES Location/Qualifiers source 1..5829 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 17..605 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(791..933) /label=bom /note="basis of mobility region from pBR322" CDS complement(1038..1226) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(2001..2022) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(2038..3117) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(3118..3195) /label=lacI promoter promoter 3504..3522 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 3523..3547 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 3562..3584 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 3592..4305 /codon_start=1 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Nager et al., 2011)" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDG TYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKA NFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" CDS 4312..4329 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 4339..4356 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 4423..4470 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 4507..4962 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(5054..5710) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(5711..5813) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.