Basic Vector Information
- Vector Name:
- pSC101-P_bla_PtNTT2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4839 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Hashimoto K, Fischer EC, Romesberg FE.
pSC101-P_bla_PtNTT2 vector Vector Map
pSC101-P_bla_PtNTT2 vector Sequence
LOCUS 62056_19385 4839 bp DNA circular SYN 16-JUN-2021 DEFINITION Cloning vector pSC101-P_bla_PtNTT2, complete sequence. ACCESSION MW816820 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4839) AUTHORS Hashimoto K, Fischer EC, Romesberg FE. TITLE Efforts toward Further Integration of an Unnatural Base Pair into the Biology of a Semisynthetic Organism JOURNAL J Am Chem Soc (2021) In press PUBMED 34096294 REFERENCE 2 (bases 1 to 4839) AUTHORS Hashimoto K. TITLE Direct Submission JOURNAL Submitted (25-MAR-2021) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 4839) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J Am Chem Soc (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-MAR-2021) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4839 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 71..184 /label=pUC19-like /note="pUC19-like" regulatory 185..235 /regulatory_class="promoter" misc_feature 235 /label=TSS /note="TSS" misc_feature 268..273 /label=Shine-Dalgarno /note="Shine-Dalgarno" CDS 280..1815 /codon_start=1 /transl_table=11 /product="PtNTT2" /label=PtNTT2 /protein_id="QWO78774.1" /translation="MGGSTVAPTTPLATGGALRKVRQAVFPIYGNQEVTKFLLIGSIKF FIILALTLTRDTKDTLIVTQCGAEAIAFLKIYGVLPAATAFIALYSKMSNAMGKKMLFY STCIPFFTFFGLFDVFIYPNAERLHPSLEAVQAILPGGAASGGMAVLAKIATHWTSALF YVMAEIYSSVSVGLLFWQFANDVVNVDQAKRFYPLFAQMSGLAPVLAGQYVVRFASKAV NFEASMHRLTAAVTFAGIMICIFYQLSSSYVERTESAKPAADNEQSIKPKKKKPKMSMV ESGKFLASSQYLRLIAMLVLGYGLSINFTEIMWKSLVKKQYPDPLDYQRFMGNFSSAVG LSTCIVIFFGVHVIRLLGWKVGALATPGIMAILALPFFACILLGLDSPARLEIAVIFGT IQSLLSKTSKYALFDPTTQMAYIPLDDESKVKGKAAIDVLGSRIGKSGGSLIQQGLVFV FGNIINAAPVVGVVYYSVLVAWMSAAGRLSGLFQAQTEMDKADKMEAKTNKEK" terminator 1849..1943 /label=lambda t0 terminator /note="transcription terminator from phage lambda" misc_feature 1960..2065 /label=pCDF-1b-like /note="pCDF-1b-like" CDS complement(2166..2822) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(2823..2925) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 3270..3492 /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" CDS 3540..4487 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin"
This page is informational only.