Basic Vector Information
- Vector Name:
- pEM010
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8137 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mancera E, Frazer C, Porman AM, Ruiz-Castro S
pEM010 vector Map
pEM010 vector Sequence
LOCUS 62056_9160 8137 bp DNA circular SYN 14-APR-2019 DEFINITION Cloning vector pEM010, complete sequence. ACCESSION MK431395 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8137) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz-Castro S, Johnson AD, Bennett RJ. TITLE Genetic Modification of Closely Related Candida Species JOURNAL Front Microbiol 10, 357 (2019) PUBMED 30941104 REFERENCE 2 (bases 1 to 8137) AUTHORS Mancera E, Frazer C, Porman AM, Ruiz S, Johnson AD, Bennett RJ. TITLE Direct Submission JOURNAL Submitted (23-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico REFERENCE 3 (bases 1 to 8137) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Microbiol 10, 357 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-JAN-2019) Departmento de Ingenieria Genetica, Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional, Unidad Irapuato, Km. 9.6 Libramiento Norte Carrera Irapuato-Leon, Irapuato, Guanajuato 36824, Mexico" FEATURES Location/Qualifiers source 1..8137 /mol_type="other DNA" /organism="synthetic DNA construct" misc_recomb 22..55 /label=FLP recombination target sequence (FRT) /note="FLP recombination target sequence (FRT)" misc_feature 62..1241 /label=promoter region from Candida albicans PCK1 /note="promoter region from Candida albicans PCK1" CDS 1242..2510 /label=FLP /note="site-specific recombinase" misc_feature 2514..2901 /label=terminator region from Candida albicans ACT1 /note="terminator region from Candida albicans ACT1" misc_feature 2908..3405 /label=promoter region from Candida albicans ACT1 /note="promoter region from Candida albicans ACT1" gene 3406..4632 /gene="SAT1" /label=SAT1 CDS join(3406..3415,4070..4632) /codon_start=1 /transl_table=11 /gene="SAT1" /product="streptomycin acetyltransferase" /label=SAT1 /note="nourseothricin resistance marker" /protein_id="QBY25790.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" misc_feature 4636..4765 /label=terminator region from Candida albicans URA3 /note="terminator region from Candida albicans URA3" protein_bind complement(4770..4803) /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" primer_bind complement(4805..4821) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(4858..4876) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4897..4913) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4921..4937) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4945..4975) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4990..5011) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5299..5887) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 6107..6209 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 6210..6866 /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(7357..7462) /label=AmpR promoter rep_origin 7489..7944 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 8085..8101 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 8111..8129 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.