Basic Vector Information
- Vector Name:
- pNRVL-caSAT1-6kbp
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7998 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nemeth TM.
pNRVL-caSAT1-6kbp vector Map
pNRVL-caSAT1-6kbp vector Sequence
LOCUS 62056_18205 7998 bp DNA circular SYN 20-MAR-2021 DEFINITION Cloning vector pNRVL-caSAT1-6kbp, complete sequence. ACCESSION MT948180 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7998) AUTHORS Nemeth TM. TITLE Direct Submission JOURNAL Submitted (27-AUG-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary REFERENCE 2 (bases 1 to 7998) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (27-AUG-2020) Department of Microbiology, University of Szeged, Kozep fasor 52, Szeged, Csongrad 6726, Hungary" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. v11 Sequencing Technology :: IonTorrent ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7998 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 570..575 /label=StuI site for cassette release /note="StuI site for cassette release" misc_feature 576..1039 /note="Site of recombination; CpNEUT5LUpup from C. parapsilosis" misc_feature 1040..1047 /label=NotI site for selectable marker ligation /note="NotI site for selectable marker ligation" regulatory 1094..1591 /label=Candida albicans ACT1 promoter /note="Candida albicans ACT1 promoter" /regulatory_class="promoter" gene join(1592..1601,2256..2818) /gene="caSAT1" /label=caSAT1 CDS join(1592..1601,2256..2818) /codon_start=1 /transl_table=11 /gene="caSAT1" /product="streptothricin acetyltransferase" /label=caSAT1 /note="codon-optimized for Candida albicans" /protein_id="QSX26213.1" /translation="MDGEEVAALVIDNGSHMKISVIPEQVAETLDAENHFIVREVFDVH LSDQGFELSTRSVSPYRKDYISDDDSDEDSACYGAFIDQELVGKIELNSTWNDLASIEH IVVSHTHRGKGVAHSLIEFAKKWALSRQLLGIRLETQTNNVPACNLYAKCGFTLGGIDL FTYKTRPQVSNETAMYWYWFSGAQDDA" regulatory 2822..2951 /label=Candida albicans URA3 terminator /note="Candida albicans URA3 terminator" /regulatory_class="terminator" misc_feature 2979..2984 /note="BssHII site for selectable marker and insert ligation" misc_feature 2985..5756 /note="Candida albicans intergenic region; Ca22chrRB_C_albicans_SC5314:2080135-2082906" misc_feature 5757..5762 /note="BssHII site for selectable marker and insert ligation" misc_feature 5770..5775 /label=XhoI site for insert ligation /note="XhoI site for insert ligation" misc_feature 5776..6226 /note="Site of recombination; CpNEUT5LDowndown from C. parapsilosis" promoter complement(6240..6258) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(6263..6279) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 6392..7198 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 7348..7936 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.