Basic Vector Information
- Vector Name:
- pMU1817
- Length:
- 9876 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Holwerda EK, Olson DG, Ruppertsburger NM, Stevenson D
- Promoter:
- URA3
pMU1817 vector Map
pMU1817 vector Sequence
LOCUS V016083 9876 bp DNA circular SYN 28-JAN-2019 DEFINITION Exported. ACCESSION V016083 VERSION V016083 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9876) AUTHORS Holwerda EK, Olson DG, Ruppertsburger NM, Stevenson D, Murphy SJL., Maloney MI, Lanahan A, Amador- Noguez D, Lynd LR. TITLE Evolutionary response of Clostridium thermocellum to genetic modifications aimed at improving ethanol production JOURNAL Unpublished REFERENCE 2 (bases 1 to 9876) AUTHORS Olson DG, Argyros DA. TITLE Direct Submission JOURNAL Submitted (09-OCT-2018) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9876) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-OCT-2018) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" FEATURES Location/Qualifiers source 1..9876 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(294..1094) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(1095..1315) /label="URA3 promoter" misc_feature 1343..1846 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" misc_feature complement(1888..2922) /label="3' homology region" /note="3' homology region" misc_feature complement(2923..3765) /label="5' homology region" /note="5' homology region" gene complement(3884..4429) /gene="hpt" /label="hpt" CDS complement(3884..4429) /codon_start=1 /transl_table=11 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="QAT79155.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" CDS complement(4455..5102) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory complement(5103..5630) /label="gapDH promoter from Clostridium thermocellum" /note="gapDH promoter from Clostridium thermocellum" /regulatory_class="promoter" misc_feature complement(5631..6262) /label="internal homology region" /note="internal homology region" gene complement(6263..6841) /gene="tdk" /label="tdk" CDS complement(6263..6841) /codon_start=1 /transl_table=11 /gene="tdk" /product="thymidine dikinase" /label="tdk" /protein_id="QAT79157.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" regulatory complement(6842..7462) /label="Clostridium thermocellum cbp promoter" /note="Clostridium thermocellum cbp promoter" /regulatory_class="promoter" CDS complement(7572..8573) /label="repB" /note="RepB replication protein" rep_origin complement(9265..9853) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.