pLH405 vector (V016071)

LOCUS       62056_14145        4730 bp DNA     circular SYN 27-JUL-2020
DEFINITION  Cloning vector pLH405, complete sequence.
ACCESSION   MN617157
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4730)
  AUTHORS   Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, 
            Tabor JJ.
  TITLE     Optogenetic control of gut bacterial metabolism
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4730)
  AUTHORS   Hartsough LA, Kotlajich MV, Han B, Lin C-C.J., Gambill L, Wang MC, 
            Tabor JJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2019) Bioengineering, Rice University, 6500 Main 
            St., Houston, TX 77030, USA
REFERENCE   3  (bases 1 to 4730)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (26-OCT-2019) Bioengineering, Rice University, 6500 Main St., 
            Houston, TX 77030, USA"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4730
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(72..660)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      complement(748..842)
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             complement(866..1522)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(1523..1625)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     misc_feature    1651..1685
                     /label=constitutive promoter J23114
                     /note="constitutive promoter J23114"
     regulatory      1693..1706
                     /label=RBS pprotet
                     /note="RBS pprotet"
                     /regulatory_class="ribosome_binding_site"
     misc_feature    1695..1706
                     /label=B0034
                     /note="B0034"
     CDS             1714..2421
                     /label=mCherry
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     regulatory      2425..2484
                     /label=L3S1P52
                     /note="L3S1P52"
                     /regulatory_class="terminator"
     regulatory      2564..2598
                     /label=constitutive promoter J23100
                     /note="constitutive promoter J23100"
                     /regulatory_class="promoter"
     regulatory      2599..2632
                     /label=sRBS
                     /note="sRBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             2633..3337
                     /codon_start=1
                     /transl_table=11
                     /product="CcaR"
                     /label=CcaR
                     /protein_id="QLL27764.1"
                     /translation="MRILLVEDDLPLAETLAEALSDQLYTVDIATDASLAWDYASRLEY
                     DLVILDVMLPELDGITLCQKWRSHSYLMPILMMTARDTINDKITGLDAGADDYVVKPVD
                     LGELFARVRALLRRGCATCQPVLEWGPIRLDPSTYEVSYDNEVLSLTRKEYSILELLLR
                     NGRRVLSRSMIIDSIWKLESPPEEDTVKVHVRSLRQKLKSAGLSADAIETVHGIGYRLA
                     NLTEKSLCQGKN"
     terminator      3358..3429
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      3445..3472
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     misc_feature    complement(3584..3595)
                     /label=stop region
                     /note="stop region"
     regulatory      3596..3767
                     /label=truncated PcpcG2
                     /note="truncated PcpcG2"
                     /regulatory_class="promoter"
     misc_feature    3768..3785
                     /label=B0034
                     /note="B0034"
     CDS             3786..4499
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     terminator      complement(4526..4569)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"