Basic Vector Information
- Vector Name:
- pCMV-mCherry
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5326 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Yang J, Lee J, Land MA, Lai S
pCMV-mCherry vector Map
pCMV-mCherry vector Sequence
LOCUS 62056_7205 5326 bp DNA circular SYN 14-AUG-2021 DEFINITION Cloning vector pCMV-mCherry, complete sequence. ACCESSION MZ220611 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5326) AUTHORS Yang J, Lee J, Land MA, Lai S, Igoshin OA, St-Pierre F. TITLE A synthetic circuit for buffering gene dosage variation between individual mammalian cells JOURNAL Nat Commun 12 (1), 4132 (2021) PUBMED 34226556 REFERENCE 2 (bases 1 to 5326) AUTHORS Yang J, Lee J, Land MA, Lai S, Igoshin O, St-Pierre F. TITLE Direct Submission JOURNAL Submitted (17-MAY-2021) Neuroscience, Baylor College of Medicine, One Baylor Plaza, Suite S636, Houston, TX 77030, USA REFERENCE 3 (bases 1 to 5326) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2021"; volume: "12"; issue: "1"; pages: "4132" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-MAY-2021) Neuroscience, Baylor College of Medicine, One Baylor Plaza, Suite S636, Houston, TX 77030, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5326 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal 611..658 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 987..1575 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" enhancer 1750..2053 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 2054..2257 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 2742..3449 /codon_start=1 /label=mCherry /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA EGRHSTGGMDELYK" polyA_signal 3457..3681 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" polyA_signal 3803..3924 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3931..4386) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4413..4517 /label=AmpR promoter promoter 4519..4876 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS join(4911..5326,1..376) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
This page is informational only.