Basic Vector Information
- Vector Name:
- pDRE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5329 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hua M.
pDRE vector Vector Map
pDRE vector Sequence
LOCUS V016062 5329 bp DNA circular SYN 10-FEB-2019 DEFINITION Exported. ACCESSION V016062 VERSION V016062 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5329) AUTHORS Hua M. TITLE A dual-replicon shuttle vector system for heterologous replication and expression in a broad range of gram-positive and negative bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 5329) AUTHORS Hua M. TITLE Direct Submission JOURNAL Submitted (15-JAN-2018) Institute of Infectious Diseases, Beijing Ditan Hospital, No. 8 Jingshundongjie, Beijing 100015, China, Beijing, Beijing 100015, China REFERENCE 3 (bases 1 to 5329) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JAN-2018) Institute of Infectious Diseases, Beijing Ditan Hospital, No. 8 Jingshundongjie, Beijing 100015, China, Beijing, Beijing 100015, China" FEATURES Location/Qualifiers source 1..5329 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 49..80 /label="tonB terminator" /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 81..183 /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 184..1041 /label="AmpR" /note="beta-lactamase" terminator 1068..1095 /label="T7Te terminator" /note="phage T7 early transcription terminator" rep_origin complement(1107..1694) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(1716..1745) /label="T3Te terminator" /note="phage T3 early transcription terminator" CDS 3181..3315 /gene="copG" /label="Protein CopG" /note="Protein CopG from Streptococcus agalactiae. Accession#: P13920" CDS 3379..4011 /codon_start=1 /transl_table=11 /product="RepB" /label="RepB" /protein_id="QBA30996.1" /translation="MAKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSS IKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHES KDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYD FIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRGTKNEER" CDS 4262..5245 /gene="malR" /label="HTH-type transcriptional regulator MalR" /note="HTH-type transcriptional regulator MalR from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4). Accession#: P0A4T1"
This page is informational only.