Basic Vector Information
- Vector Name:
- pMTL575555
- Length:
- 7196 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lau MSH., Sheng L, Zhang Y, Minton NP.
pMTL575555 vector Map
pMTL575555 vector Sequence
LOCUS 62056_17560 7196 bp DNA circular SYN 28-JUL-2021 DEFINITION Cloning vector pMTL575555, complete sequence. ACCESSION MZ182078 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7196) AUTHORS Lau MSH., Sheng L, Zhang Y, Minton NP. TITLE Development of a Suite of Tools for Genome Editing in Parageobacillus thermoglucosidasius and Their Use to Identify the Potential of a Native Plasmid in the Generation of Stable Engineered Strains JOURNAL ACS Synth Biol 10 (7), 1739-1749 (2021) PUBMED 34197093 REFERENCE 2 (bases 1 to 7196) AUTHORS Lau MSH., Sheng L, Zhang Y, Minton NP. TITLE Direct Submission JOURNAL Submitted (10-MAY-2021) Biodiscovery Institute, School of Life Sciences, University of Nottingham, Science Road, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom REFERENCE 3 (bases 1 to 7196) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol"; date: "2021"; volume: "10"; issue: "7"; pages: "1739-1749" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-MAY-2021) Biodiscovery Institute, School of Life Sciences, University of Nottingham, Science Road, University Park, Nottingham, Nottinghamshire NG7 2RD, United Kingdom" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7196 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(12..3374) /label=St1Cas9 /note="Cas9 endonuclease from the Streptococcus thermophilus Type II CRISPR/Cas system (Esvelt et al., 2013)" regulatory complement(3375..3559) /label=lactate dehydrogenase promoter and RBS /note="lactate dehydrogenase promoter and RBS" /regulatory_class="promoter" regulatory 3566..3656 /label=glyceraldehyde 3-phosphate dehydrogenase promoter /note="glyceraldehyde 3-phosphate dehydrogenase promoter" /regulatory_class="promoter" terminator 3794..3880 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3972..3999 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" primer_bind complement(4009..4025) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 4461..5462 /label=repB /note="RepB replication protein" CDS 5619..6389 /codon_start=1 /transl_table=11 /product="kanamycin nucleotidyltransferase" /label=kanamycin nucleotidyltransferase /protein_id="QXV87316.1" /translation="MRIVNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGR QTDGPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFYSEEILLDYASQVESDWPLTHG QFFSILPIYDSGGYLEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTT FLPSLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSD SEKLLESLENFWNGIQEWTERHGYIVDVSKRIPF" rep_origin 6397..6980 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.