Basic Vector Information
- Vector Name:
- pLG163
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8591 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez LM, Mukhitov N, Voigt CA.
pLG163 vector Vector Map
pLG163 vector Sequence
LOCUS 62056_14050 8591 bp DNA circular SYN 16-DEC-2019 DEFINITION Cloning vector pLG163, complete sequence. ACCESSION MN443775 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8591) AUTHORS Gonzalez LM, Mukhitov N, Voigt CA. TITLE Resilient living materials built by printing bacterial spores JOURNAL Nat. Chem. Biol. (2019) In press PUBMED 31792444 REFERENCE 2 (bases 1 to 8591) AUTHORS Mukhitov N, Gonzalez LM, Voigt CA. TITLE Direct Submission JOURNAL Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 8591) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol. (2019) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8591 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 106..210 /label=AmpR promoter CDS 211..1068 /label=AmpR /note="beta-lactamase" rep_origin 1242..1830 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2963..4139 /label=similar to AmyE /note="similar to AmyE" CDS complement(4266..5018) /codon_start=1 /transl_table=11 /product="SpecR" /label=SpecR /protein_id="QGV56725.1" /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR SYLGENIEWTNENVNLTINYLNNRLKKL" terminator 5347..5433 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 5452..5479 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 5559..5593 /label=lambda t0 terminator /note="minimal transcription terminator from phage lambda (Scholtissek and Grosse, 1987)" regulatory 5660..5688 /label=pSpank /note="pSpank" /regulatory_class="promoter" protein_bind 5697..5713 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." regulatory 5729..5745 /label=SpoVG /note="SpoVG" /regulatory_class="ribosome_binding_site" CDS 5749..6456 /label=yeGFP /note="yeast-enhanced green fluorescent protein" CDS 6715..7794 /label=lacI /note="lac repressor" misc_feature 7924..8591 /label=similar to AmyE /note="similar to AmyE"
This page is informational only.