Basic Vector Information
- Vector Name:
- pCJH10_pETcc2--E2Aa
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3454 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Hartley CJ, Williams CC, Scoble JA, Churches QI
- Promoter:
- tet
pCJH10_pETcc2--E2Aa vector Vector Map
pCJH10_pETcc2--E2Aa vector Sequence
LOCUS 62056_6465 3454 bp DNA circular SYN 12-DEC-2019 DEFINITION Expression vector pCJH10_pETcc2::E2Aa, complete sequence. ACCESSION MK910757 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3454) AUTHORS Hartley CJ, Williams CC, Scoble JA, Churches QI, North A, French NG, Nebl T, Coia G, Warden AC, Simpson G, Frazer AR, Nixon Jensen C, Turner NJ, Scott C. TITLE Direct Submission JOURNAL REFERENCE 2 (bases 1 to 3454) AUTHORS Hartley CJ, Williams CC, Scoble JA, Churches QI, North A, French NG, Nebl T, Coia G, Warden AC, Simpson G, Frazer AR, Nixon Jensen C, Turner NJ, Scott C. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 3454) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (10-MAY-2019) Biocatalysis " COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAY-2019) Biocatalysis " FEATURES Location/Qualifiers source 1..3454 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 2..937 /codon_start=1 /transl_table=11 /product="carboxylesterase E2" /label=carboxylesterase E2 /note="from Alicyclobacillus acidocaldarius (PDB 1U4N)" /protein_id="QGT40748.1" /translation="MMPLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEP VAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKD GRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAA VTSILAKERGGPALAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNS LEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDL IHGFAQFYSLSPGATKALVRIAEKLRDALA" terminator 959..1006 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter complement(1372..1400) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" promoter 1513..1617 /label=AmpR promoter CDS 1618..2475 /label=AmpR /note="beta-lactamase" rep_origin 2649..3237 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 3317..3335 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" RBS 3367..3389 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 3408..3425 /label=6xHis /note="6xHis affinity tag" CDS 3435..3452 /label=thrombin site /note="thrombin recognition and cleavage site"
This page is informational only.