Basic Vector Information
- Vector Name:
- pAAV-TRE-NS1NF
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5034 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Li E, Guo J, Oh SJ, Luo Y
- Promoter:
- tight TRE
pAAV-TRE-NS1NF vector Vector Map
pAAV-TRE-NS1NF vector Sequence
LOCUS 62056_2530 5034 bp DNA circular SYN 30-NOV-2021 DEFINITION Cloning vector pAAV-TRE-NS1NF, complete sequence. ACCESSION MZ708022 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5034) AUTHORS Li E, Guo J, Oh SJ, Luo Y, Oliveros HC, Du W, Arano R, Kim Y, Chen YT, Eitson J, Lin DT, Li Y, Roberts T, Schoggins JW, Xu W. TITLE Anterograde transneuronal tracing and genetic control with engineered yellow fever vaccine YFV-17D JOURNAL Nat Methods (2021) In press PUBMED 34824475 REFERENCE 2 (bases 1 to 5034) AUTHORS Xu W. TITLE Direct Submission JOURNAL Submitted (03-AUG-2021) Neuroscience, UT Southwestern Medical Center, Dallas, TX 75229, USA REFERENCE 3 (bases 1 to 5034) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Methods (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-AUG-2021) Neuroscience, UT Southwestern Medical Center, Dallas, TX 75229, USA" FEATURES Location/Qualifiers source 1..5034 /mol_type="other DNA" /organism="synthetic DNA construct" repeat_region 1..141 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" polyA_signal complement(164..245) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter 261..575 /label=tight TRE promoter /note="Tet-responsive promoter PTight, consisting of seven tet operator sequences followed by the minimal CMV promoter" CDS 612..1745 /codon_start=1 /transl_table=11 /product="NS1" /label=NS1 /protein_id="UBZ25899.1" /translation="MNMTMSMSMILVGVIMMFLSLGVGADQGCAINFGKRELKCGDGIF IFRDSDDWLNKYSYYPEDPVKLASIVKASFEEGKCGLNSVDSLEHEMWRSRADEINAIF EENEVDISVVVQDPKNVYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIIDGK SRKECPFSNRVWNSFQIEEFGTGVFTTRVYMDAVFEYTIDCDGSILGAAVNGKKSAHGS PTFWMGSHEVNGTWMIHTLEALDYKECEWPLTHTIGTSVEESEMFMPRSIGGPVSSHNH IPGYKVQTNGPWMQVPLEVKREACPGTSVIIDGNCDGRGKSTRSTTDSGKVIPEWCCRS CTMPPVSFHGSDGCWYPMEIRPRKTHESHLVRSWVTA" polyA_signal 1781..2257 /label=hGH poly(A) signal /note="human growth hormone polyadenylation signal" repeat_region 2297..2437 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" rep_origin 2512..2967 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3249..3353 /label=AmpR promoter CDS 3354..4211 /label=AmpR /note="beta-lactamase" rep_origin 4385..4973 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.