Basic Vector Information
- Vector Name:
- pJexpress412
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4944 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Faber BW.
- Promoter:
- EM7
pJexpress412 vector Map
pJexpress412 vector Sequence
LOCUS 62056_13120 4944 bp DNA circular SYN 09-OCT-2019 DEFINITION Cloning vector pJexpress412, complete sequence. ACCESSION MK689178 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4944) AUTHORS Faber BW. TITLE Direct Submission JOURNAL Submitted (25-MAR-2019) Parasitology, Biomedical Primate Research Center, Lange Kleiweg 161, Rijswijk, zuid holland 2288 GJ, The Netherlands REFERENCE 2 (bases 1 to 4944) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (25-MAR-2019) Parasitology, Biomedical Primate Research Center, Lange Kleiweg 161, Rijswijk, zuid holland 2288 GJ, The Netherlands" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4944 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 86..674 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 944..960 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1424..1442 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1443..1467 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2812..2829 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 2839..2856 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2870..2917 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter 3339..3386 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 3405..3776 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" CDS 3862..4941 /codon_start=1 /label=lacI /note="lac repressor" /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ"
This page is informational only.