Basic Vector Information
- Vector Name:
- pMT405
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5672 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Taketani M, Zhang J, Zhang S, Triassi AJ
pMT405 vector Vector Map
pMT405 vector Sequence
LOCUS 62056_17465 5672 bp DNA circular SYN 19-MAY-2020 DEFINITION Cloning vector pMT405, complete sequence. ACCESSION MN991273 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5672) AUTHORS Taketani M, Zhang J, Zhang S, Triassi AJ, Huang YJ, Griffith LG, Voigt CA. TITLE Genetic circuit design automation for the gut resident species Bacteroides thetaiotaomicron JOURNAL Nat. Biotechnol. (2020) In press PUBMED 32231334 REFERENCE 2 (bases 1 to 5672) AUTHORS Taketani M, Voigt CA. TITLE Direct Submission JOURNAL Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5672) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2020) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JAN-2020) Biological Engineering, MIT, Synthetic Biology Center 500 Technology Square NE47-140, Cambridge, MA 02139, USA" FEATURES Location/Qualifiers source 1..5672 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(156..890) /codon_start=1 /transl_table=11 /product="ErmG" /label=ErmG /protein_id="QJT41631.1" /translation="MNKVNIKDSQNFITSKYHIEKIMNCISLDEKDNIFEIGAGKGHFT AGLVKRCNFVTAIEIDSKLCEVTRNKLLNYPNYQIVNDDILKFTFPSHNPYKIFGSIPY NISTNIIRKIVFESSATISYLIVEYGFAKMLLDTNRSLALLLMAEVDISILAKIPRYYF HPKPKVDSTLIVLKRKPAKMAFKERKKYETFVMKWVNKEYEKLFTKNQFNKALKHARIY DINNISFEQFVSLFNSYKIFNG" CDS 1378..2235 /label=AmpR /note="beta-lactamase" oriT complement(2369..2478) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 2649..3037 /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 3078..3107 /label=tL17 /note="tL17" /regulatory_class="terminator" misc_feature 3204..3272 /label=LacZ alpha /note="LacZ alpha" primer_bind 3344..3360 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 3361..3417 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(3430..3446) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3454..3470) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3478..3508) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3523..3544) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." regulatory 3544..3564 /label=lacO3 /note="lacO3" /regulatory_class="other" regulatory 3656..3716 /label=L3S2P21 /note="L3S2P21" /regulatory_class="terminator" misc_recomb 3960..4289 /label=attN1 region /note="attN1 region" misc_feature 4087..4100 /label=CC Region /note="CC Region" misc_difference 4099 /replace="g" /label=mutated for higher integration efficiency /note="mutated for higher integration efficiency" CDS 4305..5642 /codon_start=1 /transl_table=11 /product="IntN1" /label=IntN1 /note="NBU1 integrase" /protein_id="QJT41633.1" /translation="MKVTFIIKKAAKRYDTESMATIYVRFRNGRQLDSVAPTQLAINPN LWDDKDECVKTKAVCNEEMRTHINEEIRQLKTYIEKVYQQEKEAIDKEWLKTTLDKFYH PEKYFLPEEVVIKPTIGELFDEFLNKHPLSEVRKKNFRVVKRALLRYELYVRATKRGQK GFILDVDLVTPDTLRDMWDFFQNEYQYYELYPSIYEAIPEKRTPQPRSKNTLIDCFSRI RTFFLWCFDNKRTTNRPFDKFPIEECTYGTPYYITLEERDRIFNADLSATPQLAIQRDI FIFQTLIGCRVSDLYRMTKLNVVNEAIEYIPKKTKEGNPVTVRVPLNDKAKEILERYKE YEGKLLPFISEQKYNDAIKKIFKLAGVDRIVTILDPLTHNEIKRPIYEVASSHLARRTF IGNIYKKVKDPNLVSALSGHKEGSKAFRRYRDIDEEMKKDLVKLLD"
This page is informational only.