Basic Vector Information
- Vector Name:
- GalS_GKR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3894 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
GalS_GKR vector Map
GalS_GKR vector Sequence
LOCUS 62056_996 3894 bp DNA circular SYN 03-DEC-2019 DEFINITION Cloning vector GalS_GKR, complete sequence. ACCESSION MN207933 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3894) AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ. TITLE Transcriptional programming using engineered systems of transcription factors and genetic architectures JOURNAL Nat Commun 10 (1), 4784 (2019) PUBMED 31636266 REFERENCE 2 (bases 1 to 3894) AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ. TITLE Direct Submission JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States REFERENCE 3 (bases 1 to 3894) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3894 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 596..673 /label=lacI promoter CDS 674..1720 /codon_start=1 /transl_table=11 /product="GalS GKR" /label=GalS GKR /protein_id="QFU95531.1" /translation="MKPVTLYDVAEYAGVSGKTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAAQLAGKQSDTIGVVVMDVSDAFFGALVKAVDLVAQQHQKYVLIGNSYHEAE KERHAIEVLIRQRCNALIVHSKALSDDELAQFMDNIPGMVLINRVVPGYAHRCVCLDNL SGARMATRMLLNNGHQRIGYLSSSHGIEDDAMRKAGWMSALKEQDIIPPESWIGAGTPD MPGGEAAMVELLGRNLQLTAVFAYNDNMAAGALTALKDNGIAIPLHLSIIGFDDIPIAR YTDPQLTTVRYPIASMAKLATELALQGAAGNIDPRASHCFMPTLVRRHSVATRQNAAAI TNSTNQAM" protein_bind 1850..1871 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin 2062..2606 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 3132..3234 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 3235..3891 /label=CmR /note="chloramphenicol acetyltransferase"
This page is informational only.