Basic Vector Information
- Vector Name:
- pET24-Tn_ram106B
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8179 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Baudrexl M, Schwarz WH, Zverlov VV, Liebl W.
pET24-Tn_ram106B vector Map
pET24-Tn_ram106B vector Sequence
LOCUS 62056_9835 8179 bp DNA circular SYN 30-NOV-2020 DEFINITION Cloning vector pET24-Tn_ram106B, complete sequence. ACCESSION MT031856 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8179) AUTHORS Baudrexl M, Schwarz WH, Zverlov VV, Liebl W. TITLE Biochemical characterisation of four rhamnosidases from thermophilic bacteria of the genera Thermotoga, Caldicellulosiruptor and Thermoclostridium JOURNAL Sci Rep 9 (1), 15924 (2019) PUBMED 31685873 REFERENCE 2 (bases 1 to 8179) AUTHORS Baudrexl M. TITLE Direct Submission JOURNAL Submitted (06-FEB-2020) Microbiology, TU Munich, Emil-Ramann-Str. 4, Freising, Deutschland 85354, Deutschland REFERENCE 3 (bases 1 to 8179) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep"; date: "2019"; volume: "9"; issue: "1"; pages: "15924" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-FEB-2020) Microbiology, TU Munich, Emil-Ramann-Str. 4, Freising, Deutschland 85354, Deutschland" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8179 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(563..1375) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1497..2085 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2271..2413) /label=bom /note="basis of mobility region from pBR322" CDS complement(2518..2706) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(3481..3502) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3518..4597) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4598..4675) /label=lacI promoter promoter 4984..5002 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5003..5027 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5042..5064 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 8020..8040 /codon_start=1 /label=7xHis /note="6xHis affinity tag" /translation="HHHHHHH" terminator 8107..8154 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.