Basic Vector Information
- Vector Name:
- pAAV-TRE-NS1-dTomato
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5842 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Li E, Guo J, Oh SJ, Luo Y
- Promoter:
- bidirectional TRE
pAAV-TRE-NS1-dTomato vector Map
pAAV-TRE-NS1-dTomato vector Sequence
LOCUS 62056_2525 5842 bp DNA circular SYN 30-NOV-2021 DEFINITION Cloning vector pAAV-TRE-NS1-dTomato, complete sequence. ACCESSION MZ708021 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5842) AUTHORS Li E, Guo J, Oh SJ, Luo Y, Oliveros HC, Du W, Arano R, Kim Y, Chen YT, Eitson J, Lin DT, Li Y, Roberts T, Schoggins JW, Xu W. TITLE Anterograde transneuronal tracing and genetic control with engineered yellow fever vaccine YFV-17D JOURNAL Nat Methods (2021) In press PUBMED 34824475 REFERENCE 2 (bases 1 to 5842) AUTHORS Xu W. TITLE Direct Submission JOURNAL Submitted (03-AUG-2021) Neuroscience, UT Southwestern Medical Center, Dallas, TX 75229, USA REFERENCE 3 (bases 1 to 5842) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Methods (2021) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-AUG-2021) Neuroscience, UT Southwestern Medical Center, Dallas, TX 75229, USA" FEATURES Location/Qualifiers source 1..5842 /mol_type="other DNA" /organism="synthetic DNA construct" repeat_region 1..141 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" polyA_signal complement(164..245) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(263..964) /label=dTomato /note="dimeric variant of DsRed fluorescent protein (Shaner et al., 2004)" CDS complement(962..982) /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" promoter 996..1383 /label=bidirectional TRE promoter /note="Tet-responsive bidirectional promoter PTight-BI, consisting of seven tet operator sequences flanked on each side by the minimal CMV promoter" CDS 1420..2553 /codon_start=1 /transl_table=11 /product="NS1" /label=NS1 /protein_id="UBZ25898.1" /translation="MNMTMSMSMILVGVIMMFLSLGVGADQGCAINFGKRELKCGDGIF IFRDSDDWLNKYSYYPEDPVKLASIVKASFEEGKCGLNSVDSLEHEMWRSRADEINAIF EENEVDISVVVQDPKNVYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIIDGK SRKECPFSNRVWNSFQIEEFGTGVFTTRVYMDAVFEYTIDCDGSILGAAVNGKKSAHGS PTFWMGSHEVNGTWMIHTLEALDYKECEWPLTHTIGTSVEESEMFMPRSIGGPVSSHNH IPGYKVQTNGPWMQVPLEVKREACPGTSVIIDGNCDGRGKSTRSTTDSGKVIPEWCCRS CTMPPVSFHGSDGCWYPMEIRPRKTHESHLVRSWVTA" polyA_signal 2589..3065 /label=hGH poly(A) signal /note="human growth hormone polyadenylation signal" repeat_region 3105..3245 /label=AAV2 ITR /note="inverted terminal repeat of adeno-associated virus serotype 2" rep_origin 3320..3775 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4057..4161 /label=AmpR promoter CDS 4162..5019 /label=AmpR /note="beta-lactamase" rep_origin 5193..5781 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.