Master_Architecture_RbsR_HQN vector (V015973)

LOCUS       62056_1540        5228 bp DNA     circular SYN 03-DEC-2019
DEFINITION  Cloning vector Master_Architecture_RbsR_HQN, complete sequence.
ACCESSION   MN207947
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5228)
  AUTHORS   Rondon RE, Groseclose TM, Short AE, Wilson CJ.
  TITLE     Transcriptional programming using engineered systems of 
            transcription factors and genetic architectures
  JOURNAL   Nat Commun 10 (1), 4784 (2019)
  PUBMED    31636266
REFERENCE   2  (bases 1 to 5228)
  AUTHORS   Rondon RE, Groseclose T, Short A, Wilson CJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, 
            Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, 
            Atlanta, GA 30332, United States
REFERENCE   3  (bases 1 to 5228)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat 
            Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia 
            Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 
            30332, United States"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5228
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      51..56
                     /label=trc promoter -35 hexamer TTGACA
                     /note="trc promoter -35 hexamer TTGACA"
                     /regulatory_class="promoter"
     regulatory      57..73
                     /label=operator Ottg
                     /note="operator Ottg"
                     /regulatory_class="other"
     regulatory      74..79
                     /label=trc promoter -10 hexamer TATAAT
                     /note="trc promoter -10 hexamer TATAAT"
                     /regulatory_class="promoter"
     regulatory      95..114
                     /label=operator Oagg
                     /note="operator Oagg"
                     /regulatory_class="other"
     regulatory      133..182
                     /label=RiboJ10
                     /note="RiboJ10"
                     /regulatory_class="insulator"
     regulatory      224..235
                     /label=strong bacterial RBS
                     /note="strong bacterial RBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             242..955
                     /label=superfolder GFP
                     /note="GFP variant that folds robustly even when fused to
                     poorly folded proteins (Nager et al., 2011)"
     terminator      970..1056
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     CDS             complement(1261..2208)
                     /label=Rep101
                     /note="RepA protein needed for replication with the pSC101 
                     origin"
     rep_origin      complement(2256..2478)
                     /direction=LEFT
                     /label=pSC101 ori
                     /note="low-copy replication origin that requires the Rep101
                     protein"
     regulatory      2565..2570
                     /label=pLL promoter -35 hexamer TTGACA
                     /note="pLL promoter -35 hexamer TTGACA"
                     /regulatory_class="promoter"
     regulatory      2571..2587
                     /label=operator Osym
                     /note="operator Osym"
                     /regulatory_class="other"
     regulatory      2588..2593
                     /label=pLL promoter -10 hexamer GATACT
                     /note="pLL promoter -10 hexamer GATACT"
                     /regulatory_class="promoter"
     regulatory      2609..2628
                     /label=operator Otta
                     /note="operator Otta"
                     /regulatory_class="other"
     misc_RNA        2646..2696
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     regulatory      2698..2719
                     /label=RiboJ
                     /note="RiboJ"
                     /regulatory_class="insulator"
     regulatory      2724..2735
                     /label=strong bacterial RBS
                     /note="strong bacterial RBS"
                     /regulatory_class="ribosome_binding_site"
     CDS             2742..3740
                     /codon_start=1
                     /transl_table=11
                     /product="RbsR HQN"
                     /label=RbsR HQN
                     /protein_id="QFU95565.1"
                     /translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKASHTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQ
                     RMNRNLETLMQKRVDGLLLLCTETHQPSREIMQRYPTVPTVMMDWAPFDGDSDLIQDNS
                     LLGGDLATQYLIDKGHTRIACITGPLDKTPARLRLEGYRAAMKRAGLNIPDGYEVTGDF
                     EFNGGFDAMRQLLSHPLRPQAVFTGNDAMAVGVYQALYQAELQVPQDIAVIGYDDIELA
                     SFMTPPLTTIHQPKDELGELAIDVLIHRITQPTLQQQRLQLTPILMERGSA"
     terminator      3741..3772
                     /label=tonB terminator
                     /note="bidirectional E. coli tonB-P14 transcription
                     terminator"
     terminator      complement(4173..4267)
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             complement(4301..5092)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"