Basic Vector Information
- Vector Name:
- pQS1
- Length:
- 4906 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Park S.
pQS1 vector Map
pQS1 vector Sequence
LOCUS V015962 4906 bp DNA circular SYN 27-FEB-2021 DEFINITION Exported. ACCESSION V015962 VERSION V015962 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4906) AUTHORS Park S. TITLE Direct Submission REFERENCE 2 (bases 1 to 4906) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (03-DEC-2020) Food Science " FEATURES Location/Qualifiers source 1..4906 /mol_type="other DNA" /organism="synthetic DNA construct" gene 1..996 /gene="repF" /label="repF" CDS 1..996 /codon_start=1 /transl_table=11 /gene="repF" /product="RepF" /label="repF" /note="replication protein" /protein_id="QRY06363.1" /translation="MQYNTTRSITENQDNKTLKDMTKSGKQRPWREKKIDNVSYADILE ILKIKKAFNVKQCGNILEFKPTDEGYLKLHKTWFCKSKLCPVCNWRRAMKNSYQAQKVI EKVIKEKPKARWLFLTLSTKNAIDGDTLEQSLKHLTKAFDRLSRYKKVKQNLVGFMRST EVTVNKNDGSYNQHMHVLLCVENAYFRKKENYITQEEWVNLWQRALQVDYRPVANVKAI KPNRKGDKDIESAIKETSKYSVKSSDFLTDDDEKNQEIVSDLEKGLYRKRMLSYGGLLK QKHKILNLDDVEDGNLINASDEDKTTDEEEKAHSITAIWNFEKQNYYLRH" rep_origin 1179..1567 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" regulatory 1580..1824 /label="sarA P1 promoter" /note="sarA P1 promoter" /regulatory_class="promoter" CDS 1847..2329 /gene="dfrA" /label="Dihydrofolate reductase type 1" /note="Dihydrofolate reductase type 1 from Tn4003 from Staphylococcus aureus. Accession#: P13955" regulatory 2340..2639 /label="blaZ transcription terminator" /note="blaZ transcription terminator" /regulatory_class="terminator" regulatory 2658..2795 /label="agr P3 promoter" /note="agr P3 promoter" /regulatory_class="promoter" CDS 2821..3534 /label="GFPuv" /note="GFP variant optimized for excitation by UV light" regulatory 3592..3649 /label="atl transcription terminator" /note="atl transcription terminator" /regulatory_class="terminator" CDS complement(4484..4495) /label="WELQut site" /note="WELQut protease recognition and cleavage site"
This page is informational only.