Basic Vector Information
- Vector Name:
- pLT_196
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3418 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Tian L, Conway PM, Cervenka ND, Cui J
- Promoter:
- rhaB
pLT_196 vector Map
pLT_196 vector Sequence
LOCUS 62056_14490 3418 bp DNA circular SYN 27-AUG-2019 DEFINITION Expression vector pLT_196, complete sequence. ACCESSION MK542538 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3418) AUTHORS Tian L, Conway PM, Cervenka ND, Cui J, Maloney M, Olson DG, Lynd LR. TITLE Metabolic engineering of Clostridium thermocellum for n-butanol production from cellulose JOURNAL Biotechnol Biofuels 12, 186 (2019) PUBMED 31367231 REFERENCE 2 (bases 1 to 3418) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (18-FEB-2019) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, New Hampshire 03755, United States REFERENCE 3 (bases 1 to 3418) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels 12, 186 (2019)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-FEB-2019) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, New Hampshire 03755, United States" FEATURES Location/Qualifiers source 1..3418 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 16..134 /label=rhaB promoter /note="promoter of the E. coli rhaBAD operon, conferring tight induction with L-rhamnose and repression with D-glucose in the presence of RhaR and RhaS (Giacalone et al., 2006)" CDS 1337..1354 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1388..1435 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" terminator 1533..1562 /label=T3Te terminator /note="phage T3 early transcription terminator" rep_origin 1659..2247 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(2379..2406) /label=T7Te terminator /note="phage T7 early transcription terminator" CDS complement(2433..3239) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(3240..3330) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.