Basic Vector Information
- Vector Name:
- pT7-VP7(02V0002G3)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3484 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK
pT7-VP7(02V0002G3) vector Vector Map
pT7-VP7(02V0002G3) vector Sequence
LOCUS 62056_20860 3484 bp DNA circular SYN 15-DEC-2020 DEFINITION Cloning vector pT7-VP7(02V0002G3), complete sequence. ACCESSION MN689784 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3484) AUTHORS Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK, Johne R. TITLE Potential of avian and mammalian species A rotaviruses to reassort as explored by plasmid only-based reverse genetics JOURNAL Virus Res 286, 198027 (2020) PUBMED 32442596 REFERENCE 2 (bases 1 to 3484) AUTHORS Patzina-Mehling C, Falkenhagen A, Trojnar E, Gadicherla AK, Johne R. TITLE Direct Submission JOURNAL Submitted (13-NOV-2019) Unit Viruses in Food, German Federal Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277, Germany REFERENCE 3 (bases 1 to 3484) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Virus Res 286, 198027 (2020)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-NOV-2019) Unit Viruses in Food, German Federal Institute for Risk Assessment, Diedersdorfer Weg 1, Berlin 12277, Germany" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3484 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 6..22 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 233..251 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" 5'UTR 250..298 gene 299..1288 /gene="VP7" /label=VP7 CDS 299..1288 /codon_start=1 /transl_table=11 /gene="VP7" /product="VP7" /label=VP7 /note="derived from Rotavirus A strain 02V0002G3" /protein_id="QPP12453.1" /translation="MYSTECTILSIEIIFYFIIVLLIYDIIHRMASSYVFCISVFIIAV TILPRCHAQNYGVNVPITGSLDITVQNQTAEPIGLTSTLCLYYPAEASTEIADTEWKQT ISQLFLTKGWPTTSIYFNEYQDLQTFSNNPSINCDYNIILIKYDGNQGLDISEIAELLL YEWLCNEMDISLYYYQQTSEANKWIAMGTDCTVKVCPLNTQTLGIGCKTTDVSTFEQLT TAEKLAIIDVVDGVNHKIDYTVTTCNVKNCMRLNQRENVAIIQVGGPEIIDVSEDPMVV PKMQRVTRINWKRWWQVFYTIVDYINTIVQTMSRRSRSLNTSAYYFRV" 3'UTR 1289..1315 terminator 1476..1523 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" primer_bind complement(1692..1708) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" terminator 1756..1787 /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 1788..1890 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 1891..2748 /label=AmpR /note="beta-lactamase" terminator 2823..2850 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(2862..3449) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.