Basic Vector Information
- Vector Name:
- pso_CelR_HQN
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3679 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rondon RE, Groseclose TM, Short AE, Wilson CJ.
pso_CelR_HQN vector Map
pso_CelR_HQN vector Sequence
LOCUS 62056_20070 3679 bp DNA circular SYN 03-DEC-2019 DEFINITION Cloning vector pso_CelR_HQN, complete sequence. ACCESSION MN207948 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3679) AUTHORS Rondon RE, Groseclose TM, Short AE, Wilson CJ. TITLE Transcriptional programming using engineered systems of transcription factors and genetic architectures JOURNAL Nat Commun 10 (1), 4784 (2019) PUBMED 31636266 REFERENCE 2 (bases 1 to 3679) AUTHORS Rondon RE, Groseclose T, Short A, Wilson CJ. TITLE Direct Submission JOURNAL Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States REFERENCE 3 (bases 1 to 3679) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "4784" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUL-2019) Chemical and Biomolecular Engineering, Georgia Institute of Technology, 950 Atlantic dr. NW, 5110E, Atlanta, GA 30332, United States" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3679 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 101..289 /label=rop /note="Rop protein, which maintains plasmids at low copy number" misc_feature 394..536 /label=bom /note="basis of mobility region from pBR322" promoter 693..797 /label=AmpR promoter CDS 798..1655 /label=AmpR /note="beta-lactamase" rep_origin 1829..2417 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 2553..2630 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 2631..3644 /codon_start=1 /transl_table=11 /product="CelR HQN" /label=CelR HQN /protein_id="QFU95569.1" /translation="MKPVTLYDVAEYAGVSHQTVSNVVNQASHVSAKTREKVEAAIKEL GYVPNRAARTLVTRRTDTVALVVSENNQKLFAEPFYAGIVLGVGVALSERGFQFVLATG RSGIEHERLGGYLAGQHVDGVLLLSLHRDDPLPQMLDEAGVPYVYGGRPLGVPEEQVSY VDIDNIGGGRQATQRLIETGHRRIATIAGPQDMVAGVERLQGYREALLAAGMEYDETLV SYGDFTYDSGVAAMRELLDRAPDVDAVFAASDLMGLAALRVLRASGRRVPEDVAVVGYD DSTVAEHAEPPMTSVNQPTELMGREMARLLVDRITGETTEPVRLVLETHLMVRESG"
This page is informational only.