Basic Vector Information
- Vector Name:
- pFA-myc-NAT1-Clox
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7429 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F
- Promoter:
- TEF
pFA-myc-NAT1-Clox vector Map
pFA-myc-NAT1-Clox vector Sequence
LOCUS 62056_10645 7429 bp DNA circular SYN 17-JUL-2019 DEFINITION Cloning vector pFA-myc-NAT1-Clox, complete sequence. ACCESSION MK652128 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7429) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE A new toolkit for gene tagging in Candida albicans containing recyclable markers JOURNAL PLoS ONE (2019) In press REFERENCE 2 (bases 1 to 7429) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE Direct Submission JOURNAL Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain REFERENCE 3 (bases 1 to 7429) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE (2019) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain" COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 13 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7429 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 54..83 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" regulatory 222..477 /note="Transcriptional termination from Saccharomyces cerevisiae URA3 gene" /regulatory_class="terminator" primer_bind 487..503 /label=SK primer /note="common sequencing primer, one of multiple similar variants" misc_feature 517..550 /label=loxP /note="loxP" terminator complement(961..1158) /label=TEF terminator /note="Ashbya gossypii TEF terminator" CDS complement(1176..1739) /label=NrsR /note="nourseothricin acetyltransferase" promoter complement(1759..2102) /label=TEF promoter /note="Ashbya gossypii TEF promoter" regulatory 2166..3497 /note="CaMET3 promoter; inducible upon growth without methionine repressible via addition of methionine and cysteine to the medium" /regulatory_class="promoter" CDS join(3525..3928,4093..4720) /codon_start=1 /transl_table=11 /product="Cre" /label=Cre /note="Cre recombinase" /protein_id="QDK59785.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" intron 3929..4092 /note="modified TUB2 intron sequence" 3'UTR 4733..4863 /label=Saccharomyces cerevisiae ADH1 3'UTR region /note="Saccharomyces cerevisiae ADH1 3'UTR region" regulatory 4864..4923 /note="Transcriptional termination from Saccharomyces cerevisiae CYC1 gene" /regulatory_class="terminator" protein_bind complement(4936..4969) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter complement(5067..5085) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(5343..5931) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6105..6962) /label=AmpR /note="beta-lactamase" promoter complement(6963..7067) /label=AmpR promoter promoter 7413..7429 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.