Basic Vector Information
- Vector Name:
- pCW702-E6E7
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9540 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wang C.
pCW702-E6E7 vector Map
pCW702-E6E7 vector Sequence
LOCUS V015901 9540 bp DNA circular SYN 06-JUL-2021 DEFINITION Exported. ACCESSION V015901 VERSION V015901 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9540) AUTHORS Wang C. TITLE Direct Submission JOURNAL Submitted (13-MAY-2020) Sichuan University, West China School of Public Health, Renmin Nan Road, Chengdu, Sichuan 610041, China REFERENCE 2 (bases 1 to 9540) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (13-MAY-2020) Sichuan University, West China School of Public Health, Renmin Nan Road, Chengdu, Sichuan 610041, China" FEATURES Location/Qualifiers source 1..9540 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 515..703 /label="rop" /note="Rop protein, which maintains plasmids at low copy number" primer_bind complement(700..722) /label="pGEX_3 primer" /note="pGEX_3 primer" misc_feature 808..948 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(1134..1722) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1896..2753) /label="AmpR" /note="beta-lactamase" promoter complement(2754..2858) /label="AmpR promoter" CDS 2908..3966 /codon_start=1 /transl_table=11 /product="zinc metalloproteinase" /label="zinc metalloproteinase" /protein_id="QXF31294.1" /translation="MTLTYKNRRITRPFRLQEFPAWSHTTVGGLPITEWISEDEQGAMD TIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIY IGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDKGGEIDSFVHYGLNCNNAF WDGQEILYGDGDKKNFKPFSCAKTIVGHELTHAVIQYSAGLEYEGQSGALNESFADVFG YFIAPNHWLIGEDVCVRGSRDGRIRSIKDPDKYNQAAHMKDYESLPITEEGDWGGVHYN SGIPNKAAYNTITKLGKEKTEQRRFRALKYYLTKKAQFTDAKKALQQAAKDLYGEDASK KVAEAWEAVGVN" CDS 4344..4370 /label="HA" /note="HA (human influenza hemagglutinin) epitope tag" CDS 5334..5366 /label="VSV-G tag" /note="epitope tag from vesicular stomatitis virus G protein" CDS complement(5783..6514) /codon_start=1 /transl_table=11 /product="DNA alkylation repair protein" /label="DNA alkylation repair protein" /protein_id="QXF31296.1" /translation="MRLRMLFLLYLLYSRGVTRMITFDQLDTELQALENPNTIKIFRNH GCPDSLDLYGLKIGDLKKIIRREKLTKNHELAVKLIESNNSDLIYLGLLAINPNKITTE QIEKWNIAFRETWSQLTFGLASIVSKRDDALLFAKTWIESDYDLTKSMGWQIYSEHINN LPEAETLLQRAKETLQTETNRTRYSMNGFIITCGIYKDDLHEKAMEAAKSVGKVHVNLG NTACKVPDAISYIEKARNRTK" CDS 7220..7951 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979"
This page is informational only.