pBBR5pemIK-pKan vector (V015900)

LOCUS       62056_3745        7309 bp DNA     circular SYN 06-DEC-2019
DEFINITION  Cloning vector pBBR5pemIK-pKan, complete sequence.
ACCESSION   MN044103
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7309)
  AUTHORS   Burbank L, Wei W.
  TITLE     Broad-Host-Range Plasmids for Constitutive and Inducible Gene 
            Expression in the Absence of Antibiotic Selection
  JOURNAL   Microbiol Resour Announc 8 (36), e00769-19 (2019)
  PUBMED    31488530
REFERENCE   2  (bases 1 to 7309)
  AUTHORS   Burbank LP, Wei W.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2019) Crop Diseases Pests and Genetics Research 
            Unit, USDA Agricultural Research Service, 9611 S Riverbend Ave, 
            Parlier, CA 93648, USA
REFERENCE   3  (bases 1 to 7309)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol 
            Resour Announc"; date: "2019"; volume: "8"; issue: "36"; pages: 
            "e00769-19"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-JUN-2019) Crop Diseases Pests and Genetics Research Unit, USDA 
            Agricultural Research Service, 9611 S Riverbend Ave, Parlier, CA 
            93648, USA"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7309
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      1..772
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             773..1432
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
     primer_bind     2144..2160
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2170..2188
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      2202..2340
                     /label=pKan
                     /note="pKan"
                     /regulatory_class="promoter"
     primer_bind     2341..2357
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    2366..2490
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        2515..2545
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             2599..3255
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             3600..3902
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(3946..4070)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             4162..4425
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin PemI"
                     /label=antitoxin PemI
                     /protein_id="QDJ95336.1"
                     /translation="MHTTNLRKVGGSIMLAVPPAFLDQLHLEVGATVGLAVTDGRLVIE
                     PVLHPQYTLDQLLAEAEASGAYPLPPEEREWVDAPAVGRELI"
     CDS             4386..4748
                     /codon_start=1
                     /transl_table=11
                     /product="mRNA interferase PemK"
                     /label=mRNA interferase PemK
                     /protein_id="QDJ95337.1"
                     /translation="MGRCSSSRTRTDMKRGDVYMVDLEPTAGHEQRGHRPVVVISSERF
                     NRLTSCPVILPITNGGEFASRLGFAVELLGTITTGVVRCDQPRALDLLARNARKVESLP
                     PNILADVLAKAVTIFQ"
     primer_bind     complement(4809..4825)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(4855..4873)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(4894..4910)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4918..4934)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4942..4972)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4987..5008)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        5278..5306
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             5495..6025
                     /label=GmR
                     /note="gentamycin acetyltransferase"