pFLP19 vector (V015886)

Download GeneBank File(.gb)

LOCUS       V015886                 5256 bp    DNA     circular SYN 01-FEB-2020
DEFINITION  Exported.
ACCESSION   V015886
VERSION     V015886
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5256)
  AUTHORS   Gunadi A, Orchard N, Qu F, Finer J.
  TITLE     Enhanced CRISPR/Cas9 mediated homology-independent targeted
            integration in plant cotyledonary tissues
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5256)
  AUTHORS   Gunadi A, Orchard N, Qu F, Finer J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2019) Horticulture and Crop Science, The Ohio
            State University, 216 Williams Hall, 1680 Madison Ave., Wooster, OH
            44691, USA
REFERENCE   3  (bases 1 to 5256)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (06-JUN-2019) Horticulture and Crop Science, The Ohio State
            University, 216 Williams Hall, 1680 Madison Ave., Wooster, OH 44691,
            USA"
FEATURES             Location/Qualifiers
     source          1..5256
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    32..53
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        68..98
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    106..122
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     130..146
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        254..925
                     /label="CaMV 35S promoter (enhanced)"
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     regulatory      924..1067
                     /note="5' UTR enhancer sequence from Tobacco Etch Virus
                     (TEV)"
                     /regulatory_class="enhancer"
     CDS             1068..1568
                     /note="RNA silencing suppressor p19 from Tomato bushy stunt
                     virus (strain Cherry). Accession#: P11690"
                     /label="RNA silencing suppressor p19"
     regulatory      1572..1783
                     /label="CaMV35S terminator"
                     /note="CaMV35S terminator"
                     /regulatory_class="terminator"
     gene            1784..2476
                     /gene="hygR"
                     /label="hygR"
     CDS             1784..2476
                     /codon_start=1
                     /transl_table=11
                     /gene="hygR"
                     /product="HygR"
                     /label="hygR"
                     /protein_id="QHO64459.1"
                     /translation="MQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIAD
                     PHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVI
                     DWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQL
                     YQSLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRP
                     STRPRAKE"
     terminator      2523..2775
                     /label="NOS terminator"
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(2784..2800)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        3276..3380
                     /label="AmpR promoter"
     CDS             3381..4238
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      4412..5000
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"