Basic Vector Information
- Vector Name:
- pFLP19
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5256 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Gunadi A, Orchard N, Qu F, Finer J.
- Promoter:
- CaMV 35S (enhanced)
pFLP19 vector Map
pFLP19 vector Sequence
LOCUS V015886 5256 bp DNA circular SYN 01-FEB-2020 DEFINITION Exported. ACCESSION V015886 VERSION V015886 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5256) AUTHORS Gunadi A, Orchard N, Qu F, Finer J. TITLE Enhanced CRISPR/Cas9 mediated homology-independent targeted integration in plant cotyledonary tissues JOURNAL Unpublished REFERENCE 2 (bases 1 to 5256) AUTHORS Gunadi A, Orchard N, Qu F, Finer J. TITLE Direct Submission JOURNAL Submitted (06-JUN-2019) Horticulture and Crop Science, The Ohio State University, 216 Williams Hall, 1680 Madison Ave., Wooster, OH 44691, USA REFERENCE 3 (bases 1 to 5256) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-JUN-2019) Horticulture and Crop Science, The Ohio State University, 216 Williams Hall, 1680 Madison Ave., Wooster, OH 44691, USA" FEATURES Location/Qualifiers source 1..5256 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 32..53 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 68..98 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 106..122 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 130..146 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" promoter 254..925 /label="CaMV 35S promoter (enhanced)" /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" regulatory 924..1067 /note="5' UTR enhancer sequence from Tobacco Etch Virus (TEV)" /regulatory_class="enhancer" CDS 1068..1568 /note="RNA silencing suppressor p19 from Tomato bushy stunt virus (strain Cherry). Accession#: P11690" /label="RNA silencing suppressor p19" regulatory 1572..1783 /label="CaMV35S terminator" /note="CaMV35S terminator" /regulatory_class="terminator" gene 1784..2476 /gene="hygR" /label="hygR" CDS 1784..2476 /codon_start=1 /transl_table=11 /gene="hygR" /product="HygR" /label="hygR" /protein_id="QHO64459.1" /translation="MQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIAD PHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVI DWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQL YQSLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRP STRPRAKE" terminator 2523..2775 /label="NOS terminator" /note="nopaline synthase terminator and poly(A) signal" primer_bind complement(2784..2800) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 3276..3380 /label="AmpR promoter" CDS 3381..4238 /label="AmpR" /note="beta-lactamase" rep_origin 4412..5000 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.