Basic Vector Information
- Vector Name:
- pLG320
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8388 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Gonzalez LM, Mukhitov N, Voigt CA.
pLG320 vector Vector Map
pLG320 vector Sequence
LOCUS 62056_14075 8388 bp DNA circular SYN 16-DEC-2019 DEFINITION Cloning vector pLG320, complete sequence. ACCESSION MN443780 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8388) AUTHORS Gonzalez LM, Mukhitov N, Voigt CA. TITLE Resilient living materials built by printing bacterial spores JOURNAL Nat. Chem. Biol. (2019) In press PUBMED 31792444 REFERENCE 2 (bases 1 to 8388) AUTHORS Mukhitov N, Gonzalez LM, Voigt CA. TITLE Direct Submission JOURNAL Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 8388) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol. (2019) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-SEP-2019) Biological Engineering, MIT, NE47-140, 500 Tech Square, Cambridge, MA 02139, USA" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8388 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 106..210 /label=AmpR promoter CDS 211..1068 /label=AmpR /note="beta-lactamase" rep_origin 1242..1830 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2963..4138 /label=similar to AmyE /note="similar to AmyE" gene complement(4263..5045) /gene="specR" /label=specR terminator 5341..5427 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 5446..5473 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" misc_binding 5593..5604 /label=VanO binding site /bound_moiety="VanO" regulatory 5621..5649 /label=pSpank /note="pSpank" /regulatory_class="promoter" misc_binding 5647..5658 /label=VanO binding site /bound_moiety="VanO" misc_RNA 5660..5710 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 5741..5752 /label=SpoVG /note="SpoVG" /regulatory_class="ribosome_binding_site" CDS 5761..6468 /label=yeGFP /note="yeast-enhanced green fluorescent protein" terminator 6524..6618 /label=lambda t0 terminator /note="transcription terminator from phage lambda" regulatory 6726..6796 /label=Ppen /note="Ppen" /regulatory_class="promoter" regulatory 6804..6815 /label=SpoVG /note="SpoVG" /regulatory_class="ribosome_binding_site" CDS 6821..7555 /codon_start=1 /transl_table=11 /product="VanR-IVS" /label=VanR-IVS /protein_id="QGV56734.1" /translation="MDMPRIKPGQRVMMALRKMIASGEIKSGERIAEIPTAAALGVSRM PVRIALRSLEQEGLVVRLGARGYAARGVSSDQIRDAIEVRGVLEGFAARRLAERGMTAE THARFVVLIAEGEALFAAGRLNGEDLDRYAAYNQAFHDTLVSAAGNGAVESALARNGFE PFAAAGALALDLMDLSAEYEHLLAAHRQHQAVLDAVSCGDAEGAERIMRDHALAAIRNA KVFEAAASAGAPLGAAWSIRAD" misc_feature 7721..8388 /label=similar to AmyE /note="similar to AmyE"
This page is informational only.