Basic Vector Information
- Vector Name:
- Integration-module-11-sequence
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8403 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Castillo-Hair S, Baerman E, Fujita M, Igoshin O
Integration-module-11-sequence vector Map
Integration-module-11-sequence vector Sequence
LOCUS V015849 8403 bp DNA circular SYN 29-JUL-2019 DEFINITION Exported. ACCESSION V015849 VERSION V015849 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8403) AUTHORS Castillo-Hair S, Baerman E, Fujita M, Igoshin O, Tabor J. TITLE Optogenetic control of Bacillus subtilis gene expression JOURNAL Nat Commun 10 (1), 3099 (2019) PUBMED 31308373 REFERENCE 2 (bases 1 to 8403) AUTHORS Castillo-Hair SM. TITLE Direct Submission JOURNAL Submitted (29-MAY-2019) Bioengineering, Rice University, 6100 Main St., Houston, TX 77005, USA REFERENCE 3 (bases 1 to 8403) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun"; date: "2019"; volume: "10"; issue: "1"; pages: "3099" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-MAY-2019) Bioengineering, Rice University, 6100 Main St., Houston, TX 77005, USA" FEATURES Location/Qualifiers source 1..8403 /mol_type="other DNA" /organism="synthetic DNA construct" gene 115..634 /pseudo="" /gene="amyE" /label="amyE" /note="alpha-amylase" CDS complement(647..1360) /label="superfolder GFP" /note="GFP variant that folds robustly even when fused to poorly folded proteins (Pedelacq et al., 2006)" regulatory complement(1361..1384) /label="MF001" /note="MF001" /regulatory_class="ribosome_binding_site" regulatory complement(1385..1458) /label="PrpsD" /note="PrpsD" /regulatory_class="promoter" regulatory 1400 /label="+1" /note="+1" /regulatory_class="other" regulatory complement(1408..1413) /regulatory_class="minus_10_signal" regulatory complement(1431..1436) /regulatory_class="minus_35_signal" gene 1765..2517 /gene="spc" /label="spc" CDS 1765..2517 /codon_start=1 /transl_table=11 /gene="spc" /product="spectinomycin resistance protein" /label="spc" /protein_id="QDQ17183.1" /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR SYLGENIEWTNENVNLTINYLNNRLKKL" misc_feature 2644..3833 /label="homology to PY79" /note="homology to PY79" gene 2644..3669 /pseudo="" /gene="amyE" /label="amyE" /note="alpha-amylase" CDS 5032..5763 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" rep_origin complement(6574..7162) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7336..8193) /label="AmpR" /note="beta-lactamase" promoter complement(8194..8298) /label="AmpR promoter"
This page is informational only.