Basic Vector Information
- Vector Name:
- pGEX_LacI_TetR_chPylRS_IPYE_MjTyrRS
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7190 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Fischer EC, Hashimoto K, Zhang Y, Feldman AW
pGEX_LacI_TetR_chPylRS_IPYE_MjTyrRS vector Vector Map
pGEX_LacI_TetR_chPylRS_IPYE_MjTyrRS vector Sequence
LOCUS V015840 7190 bp DNA circular SYN 19-APR-2020 DEFINITION Exported. ACCESSION V015840 VERSION V015840 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7190) AUTHORS Fischer EC, Hashimoto K, Zhang Y, Feldman AW, Dien VT, Karadeema RJ, Adhikary R, Ledbetter MP, Krishnamurthy R, Romesberg FE. TITLE New codons for efficient production of unnatural proteins in a semi-synthetic organism JOURNAL Nat. Chem. Biol. (2020) In press REFERENCE 2 (bases 1 to 7190) AUTHORS Fischer EC. TITLE Direct Submission JOURNAL Submitted (27-DEC-2019) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA REFERENCE 3 (bases 1 to 7190) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol. (2020) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-DEC-2019) Department of Chemistry, The Scripps Research Institute, 10550 North Torrey Pines Road, La Jolla, CA 92037, USA" FEATURES Location/Qualifiers source 1..7190 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 19..607 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 717..786 /label="AmpR promoter" /note="AmpR promoter" /regulatory_class="promoter" CDS 846..1466 /label="TetR" /note="tetracycline repressor TetR" terminator complement(1491..1577) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" promoter 1893..1970 /label="lacIq promoter" /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 1971..3050 /label="lacI" /note="lac repressor" promoter 3171..3201 /label="lac UV5 promoter" /note="E. coli lac promoter with an 'up' mutation" protein_bind 3209..3225 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 3254..4171 /gene="tyrS" /label="Tyrosine--tRNA ligase" /note="Tyrosine--tRNA ligase from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440). Accession#: Q57834" promoter 4371..4399 /label="tac promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 4407..4423 /label="lacI binding site" /bound_moiety="lacI" /note="lac repressor binds to the lac operator to inhibit transcription in E. coli; lac operator" CDS 4446..5705 /codon_start=1 /transl_table=11 /product="chimeric PylRS variant" /label="chimeric PylRS variant" /note="chimeric PylRS variant; Methanosarcina mazei/barkeri chPylRS(IPYE)" /protein_id="QIZ64222.1" /translation="MDKKPLDVLISATGLWMSRTGTLHKIKHYEISRSKIYIEMACGDH LVVNNSRSCRPARAFRYHKYRKTCKRCRVSDEDINNFLTRSTEGKTSVKVKVVSEPKVK KAMPKSVSRAPKPLENPVSAKASTDTSRSVPSPAKSTPNSPVPTSASAPALTKSQTDRL EVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDR GFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRAL PDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK IVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDF KNIKRAARSESYYNGISTNL" terminator 5929..5976 /label="T7 terminator" /note="transcription terminator for bacteriophage T7 RNA polymerase" regulatory 6073..6177 /label="AmpR promoter" /note="AmpR promoter" /regulatory_class="promoter" CDS 6178..7035 /label="AmpR" /note="beta-lactamase"
This page is informational only.