Basic Vector Information
- Vector Name:
- pUC57-Kan-mcr-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4506 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Suzuki M.
- Promoter:
- Pc
pUC57-Kan-mcr-2 vector Map
pUC57-Kan-mcr-2 vector Sequence
LOCUS 62056_22160 4506 bp DNA circular SYN 18-SEP-2019 DEFINITION Expression vector pUC57-Kan-mcr-2 DNA, complete sequence. ACCESSION LC498722 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4506) AUTHORS Suzuki M. TITLE Bacterial ARG expression libraries JOURNAL Unpublished REFERENCE 2 (bases 1 to 4506) AUTHORS Suzuki M. TITLE Direct Submission JOURNAL Submitted (04-SEP-2019) Contact:Masato Suzuki National Institute of Infectious Diseases, AMR Research Center; 4-2-1 Aobacho, Higashimurayama, Tokyo 189-0002, Japan REFERENCE 3 (bases 1 to 4506) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-SEP-2019) Contact:Masato Suzuki National Institute of Infectious Diseases, AMR Research Center; 4-2-1 Aobacho, Higashimurayama, Tokyo 189-0002, Japan" FEATURES Location/Qualifiers source 1..4506 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 466..494 /label=Pc promoter /note="class 1 integron promoter" gene 742..2358 /gene="mcr-2" /label=mcr-2 CDS 742..2358 /codon_start=1 /transl_table=11 /gene="mcr-2" /product="lipid A phosphoethanolamine transferase MCR-2" /label=mcr-2 /protein_id="BBN60807.1" /translation="MTSHHSWYRYSINPFVLMGLVALFLAATANLTFFEKAMAVYPVSD NLGFIISMAVAVMGAMLLIVVLLSYRYVLKPVLILLLIMGAVTSYFTDTYGTVYDTTML QNAMQTDQAESKDLMNLAFFVRIIGLGVLPSVLVAVAKVNYPTWGKGLIQRAMTWGVSL VLLLVPIGLFSSQYASFFRVHKPVRFYINPITPIYSVGKLASIEYKKATAPTDTIYHAK DAVQTTKPSERKPRLVVFVVGETARADHVQFNGYGRETFPQLAKVDGLANFSQVTSCGT STAYSVPCMFSYLGQDDYDVDTAKYQENVLDTLDRLGVGILWRDNNSDSKGVMDKLPAT QYFDYKSATNNTICNTNPYNECRDVGMLVGLDDYVSANNGKDMLIMLHQMGNHGPAYFK RYDEQFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAKSIDWLKTHEANYDVAM LYVSDHGESLGENGVYLHGMPNAFAPKEQRAVPAFFWSNNTTFKPTASDTVLTHDAITP TLLKLFDVTAGKVKDRAAFIQ" primer_bind complement(2416..2432) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2440..2456) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2464..2494) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2509..2530) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2818..3406) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3587..4393) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.