Basic Vector Information
- Vector Name:
- pLGJIF19
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7420 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Ding L, Brown DM, Glass JI.
- Promoter:
- GPD
pLGJIF19 vector Map
pLGJIF19 vector Sequence
LOCUS 62056_14095 7420 bp DNA circular SYN 29-MAY-2021 DEFINITION Cloning vector pLGJIF19, complete sequence. ACCESSION MW820851 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7420) AUTHORS Ding L, Brown DM, Glass JI. TITLE Rescue of Infectious Sindbis Virus by Yeast Spheroplast-Mammalian Cell Fusion JOURNAL Viruses 13 (4), 603 (2021) PUBMED 33916100 REFERENCE 2 (bases 1 to 7420) AUTHORS Ding L. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 7420) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Viruses"; date: "2021"; volume: "13"; issue: "4"; pages: "603" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-MAR-2021) Synthetic Biology " COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7420 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 1..442 /label=GAL1 promoter /note="inducible promoter, regulated by Gal4" misc_feature 479..484 /label=yeast translational entry site /note="yeast translational entry site" CDS 485..514 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" terminator 548..735 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" promoter 760..1403 /label=GAP promoter /note="promoter for glyceraldehyde-3-phosphate dehydrogenase; also known as the TDH3 promoter" CDS 1421..2128 /label=mCherry /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" CDS 2156..2863 /codon_start=1 /transl_table=11 /product="yeCherry" /label=yeCherry /note="red fluorescence protein; 2nd copy" /protein_id="QVS03004.1" /translation="VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGT QTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFE DGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKG EIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAE GRHSTGGMDELYK" terminator 2870..3117 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(3418..4006) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4180..4992) /label=KanR /note="aminoglycoside phosphotransferase" promoter complement(4993..5097) /label=AmpR promoter misc_feature 5134..5637 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 5893..6173 /label=TRP1 promoter CDS 6174..6830 /label=HIS3 /note="imidazoleglycerol-phosphate dehydratase, required for histidine biosynthesis" rep_origin complement(6930..7385) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 7420 /label=GAL1 /note="Saccharomyces cerevisiae galactokinase promoter"
This page is informational only.