Basic Vector Information
- Vector Name:
- pSL1180-EACMCV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7668 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hoyer JS, Fondong VN, Dallas MM, Aimone CD
pSL1180-EACMCV vector Vector Map
pSL1180-EACMCV vector Sequence
LOCUS 62056_19935 7668 bp DNA circular SYN 18-NOV-2020 DEFINITION Cloning vector pSL1180 EACMCV DNA-B 1.6mer, complete sequence. ACCESSION MT856192 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7668) AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S, Hanley-Bowdoin L. TITLE Deeply Sequenced Infectious Clones of Key Cassava Begomovirus Isolates from Cameroon JOURNAL Microbiol Resour Announc 9 (46), e00802-20 (2020) PUBMED 33184153 REFERENCE 2 (bases 1 to 7668) AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S, Hanley-Bowdoin L. TITLE Direct Submission JOURNAL Submitted (06-AUG-2020) Ecology, Evolution, and Natural Resources, Rutgers University, 14 College Farm Rd, New Brunswick, NJ 08901, USA REFERENCE 3 (bases 1 to 7668) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol Resour Announc"; date: "2020"; volume: "9"; issue: "46"; pages: "e00802-20" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-AUG-2020) Ecology, Evolution, and Natural Resources, Rutgers University, 14 College Farm Rd, New Brunswick, NJ 08901, USA" FEATURES Location/Qualifiers source 1..7668 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 171..759 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 1047..1068 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1083..1113 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1121..1137 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1145..1161 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 1242..2924 /note="duplicated part of EACMCV DNA-B partial tandem dimer, BclI to ClaI, inclusive, copy 1" misc_feature 1495..4226 /label=EACMCV DNA-B monomer unit, nick site to nick site /note="EACMCV DNA-B monomer unit, nick site to nick site" gene 1801..2565 /gene="BV1" /label=BV1 CDS 1801..2565 /codon_start=1 /transl_table=11 /gene="BV1" /product="NSP" /label=BV1 /protein_id="QNR00640.1" /translation="MYTTPRRGYRSAYRPRAIRRNYAKTPYKPVTKPPVNRRITFDSSK QVYVRRSIEDVHSGANMQLANQGQQTSYVNFPSLGVDGNGGRCFDHIKLLNLRVSGTVS VTQIGGDDPMGEQSLLRGIFLMAVIVDKRPFVPEGVNTLPTFKELFGEYDTVYGNPRLK DNIRHRYRLLGTVKQYITTEEAHVQKPVNLRRKLSNARYPVWSSFKDLDASSTGGNYKN VNKNAILVSYVWVSCERSKCDVYAQFVLNYVG" gene complement(2706..3629) /gene="BC1" /label=BC1 CDS complement(2706..3629) /codon_start=1 /transl_table=11 /gene="BC1" /product="MP" /label=BC1 /protein_id="QNR00641.1" /translation="MDNQFTVTDNTYIHSKRTEYVLTNDAAPIHLQFPSSFEQATMRLK GRCMKIDHIIIEYRNQVPFNATGSVIVEIRDNRVSLEDAAQAAFTFPIACNVDLHYFSS TYFSISEPSPWSIMYRVEDSNVVEGVKFASIKAKLRLSSAKHSTDIRFKPPTINILSKG YTKDCIDFWSVEKGETRRRLLNPTPTAHSQRPIAHRPITILPGETWATKSQLGLPCSSS QRDIGCMRSQSMRIDPTTRPLDADNDSTEYPYQGLYRLSTPVLDPGDSVSQTPSDTVSR KDLESLIETTINRCLIKTQCETPRQL" misc_feature 2925..3973 /note="unique part of EACMCV DNA-B partial tandem dimer, ClaI to BclI, noninclusive" misc_feature 3974..5656 /note="duplicated part of EACMCV DNA-B partial tandem dimer, BclI to ClaI, inclusive, copy 2" primer_bind complement(5737..5753) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 5966..6421 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 6703..6807 /label=AmpR promoter CDS 6808..7665 /label=AmpR /note="beta-lactamase"
This page is informational only.