Basic Vector Information
- Vector Name:
- pSL1180-EACMCV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7668 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hoyer JS, Fondong VN, Dallas MM, Aimone CD
pSL1180-EACMCV vector Map
pSL1180-EACMCV vector Sequence
LOCUS 62056_19935 7668 bp DNA circular SYN 18-NOV-2020
DEFINITION Cloning vector pSL1180 EACMCV DNA-B 1.6mer, complete sequence.
ACCESSION MT856192
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7668)
AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S,
Hanley-Bowdoin L.
TITLE Deeply Sequenced Infectious Clones of Key Cassava Begomovirus
Isolates from Cameroon
JOURNAL Microbiol Resour Announc 9 (46), e00802-20 (2020)
PUBMED 33184153
REFERENCE 2 (bases 1 to 7668)
AUTHORS Hoyer JS, Fondong VN, Dallas MM, Aimone CD, Deppong DO, Duffy S,
Hanley-Bowdoin L.
TITLE Direct Submission
JOURNAL Submitted (06-AUG-2020) Ecology, Evolution, and Natural Resources,
Rutgers University, 14 College Farm Rd, New Brunswick, NJ 08901, USA
REFERENCE 3 (bases 1 to 7668)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiol
Resour Announc"; date: "2020"; volume: "9"; issue: "46"; pages:
"e00802-20"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(06-AUG-2020) Ecology, Evolution, and Natural Resources, Rutgers
University, 14 College Farm Rd, New Brunswick, NJ 08901, USA"
FEATURES Location/Qualifiers
source 1..7668
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 171..759
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 1047..1068
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1083..1113
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1121..1137
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1145..1161
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 1242..2924
/note="duplicated part of EACMCV DNA-B partial tandem
dimer, BclI to ClaI, inclusive, copy 1"
misc_feature 1495..4226
/label=EACMCV DNA-B monomer unit, nick site to nick site
/note="EACMCV DNA-B monomer unit, nick site to nick site"
gene 1801..2565
/gene="BV1"
/label=BV1
CDS 1801..2565
/codon_start=1
/transl_table=11
/gene="BV1"
/product="NSP"
/label=BV1
/protein_id="QNR00640.1"
/translation="MYTTPRRGYRSAYRPRAIRRNYAKTPYKPVTKPPVNRRITFDSSK
QVYVRRSIEDVHSGANMQLANQGQQTSYVNFPSLGVDGNGGRCFDHIKLLNLRVSGTVS
VTQIGGDDPMGEQSLLRGIFLMAVIVDKRPFVPEGVNTLPTFKELFGEYDTVYGNPRLK
DNIRHRYRLLGTVKQYITTEEAHVQKPVNLRRKLSNARYPVWSSFKDLDASSTGGNYKN
VNKNAILVSYVWVSCERSKCDVYAQFVLNYVG"
gene complement(2706..3629)
/gene="BC1"
/label=BC1
CDS complement(2706..3629)
/codon_start=1
/transl_table=11
/gene="BC1"
/product="MP"
/label=BC1
/protein_id="QNR00641.1"
/translation="MDNQFTVTDNTYIHSKRTEYVLTNDAAPIHLQFPSSFEQATMRLK
GRCMKIDHIIIEYRNQVPFNATGSVIVEIRDNRVSLEDAAQAAFTFPIACNVDLHYFSS
TYFSISEPSPWSIMYRVEDSNVVEGVKFASIKAKLRLSSAKHSTDIRFKPPTINILSKG
YTKDCIDFWSVEKGETRRRLLNPTPTAHSQRPIAHRPITILPGETWATKSQLGLPCSSS
QRDIGCMRSQSMRIDPTTRPLDADNDSTEYPYQGLYRLSTPVLDPGDSVSQTPSDTVSR
KDLESLIETTINRCLIKTQCETPRQL"
misc_feature 2925..3973
/note="unique part of EACMCV DNA-B partial tandem dimer,
ClaI to BclI, noninclusive"
misc_feature 3974..5656
/note="duplicated part of EACMCV DNA-B partial tandem
dimer, BclI to ClaI, inclusive, copy 2"
primer_bind complement(5737..5753)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 5966..6421
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 6703..6807
/label=AmpR promoter
CDS 6808..7665
/label=AmpR
/note="beta-lactamase"
This page is informational only.