Basic Vector Information
- Vector Name:
- pCC-TM52
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4410 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Jordan BR, Dimas RP, Jiang X-L., Morcos F
pCC-TM52 vector Map
pCC-TM52 vector Sequence
LOCUS V015766 4410 bp DNA circular SYN 30-JUL-2019 DEFINITION Exported. ACCESSION V015766 VERSION V015766 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 4410) AUTHORS Jordan BR, Dimas RP, Jiang X-L., Morcos F, Chan CTY. TITLE Engineering DNA recognition and allosteric response properties of TetR family proteins by using a module-swapping strategy JOURNAL Nucleic Acids Res. (2019) In press REFERENCE 2 (bases 1 to 4410) AUTHORS Jordan BR, Dimas RP, Jiang X-L., Morcos F, Chan CTY. TITLE Direct Submission JOURNAL Submitted (02-MAR-2018) Department of Biology, The University of Texas at Tyler, 3900 University Blvd, BEP 133, Tyler, TX 75799, USA REFERENCE 3 (bases 1 to 4410) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2019) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-MAR-2018) Department of Biology, The University of Texas at Tyler, 3900 University Blvd, BEP 133, Tyler, TX 75799, USA" FEATURES Location/Qualifiers source 1..4410 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 59..916 /label="AmpR" /note="beta-lactamase" rep_origin 1093..1681 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator 1941..2027 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" protein_bind complement(2330..2351) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." regulatory 2387..2428 /label="bidir terminator" /note="bidir terminator" /regulatory_class="terminator" regulatory 2446..2589 /regulatory_class="promoter" CDS 2610..3185 /codon_start=1 /transl_table=11 /product="TetR-MphR" /label="TetR-MphR" /protein_id="QBZ38513.1" /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISW YELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELA DHVLAQIAAILCLMFPEHDDFQLLQPHA" terminator complement(3200..3294) /label="lambda t0 terminator" /note="transcription terminator from phage lambda" CDS complement(3335..4066) /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" promoter complement(4067..4171) /label="AmpR promoter" terminator 4325..4372 /label="T7 terminator" /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.