Basic Vector Information
- Vector Name:
- pFA-URA3-Clox
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6763 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F
pFA-URA3-Clox vector Map
pFA-URA3-Clox vector Sequence
LOCUS V015758 6763 bp DNA circular SYN 17-JUL-2019 DEFINITION Exported. ACCESSION V015758 VERSION V015758 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6763) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE A new toolkit for gene tagging in Candida albicans containing recyclable markers JOURNAL PLoS ONE (2019) In press REFERENCE 2 (bases 1 to 6763) AUTHORS Duenas-Santero E, Santos-Almeida A, Rojo-Dominguez P, del Rey F, Correa-Bordes J, Vazquez de Aldana CR. TITLE Direct Submission JOURNAL Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain REFERENCE 3 (bases 1 to 6763) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: Lasergene v. 13 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE (2019) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAR-2019) Instituto de Biologia Funcional y Genomica (IBFG), Consejo Superior de Investigaciones Cientificas, Zacarias Gonzalez 2, Salamanca, Salamanca 37007, Spain" FEATURES Location/Qualifiers source 1..6763 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 53..69 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" misc_feature 83..116 /label="loxP" /note="loxP" CDS 546..1355 /gene="URA3" /label="Orotidine 5'-phosphate decarboxylase" /note="Orotidine 5'-phosphate decarboxylase from Candida albicans (strain SC5314 / ATCC MYA-2876). Accession#: P13649" regulatory 1500..2831 /note="CaMET3 promoter; inducible upon growth without methionine repressible via addition of methionine and cysteine to the medium" /regulatory_class="promoter" CDS join(2859..3262,3427..4054) /codon_start=1 /transl_table=11 /product="Cre" /label="Cre" /note="Cre recombinase" /protein_id="QDK59752.1" /translation="MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKML LSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGL PRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAF LGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVE RWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQ RYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLE DGD" intron 3263..3426 /note="modified TUB2 intron sequence" 3'UTR 4067..4197 /label="Saccharomyces cerevisiae ADH1 3'UTR region" /note="Saccharomyces cerevisiae ADH1 3'UTR region" regulatory 4198..4257 /label="derived from Saccharomyces cerevisiae CYC1" /note="derived from Saccharomyces cerevisiae CYC1" /regulatory_class="terminator" protein_bind complement(4270..4303) /label="loxP" /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter complement(4401..4419) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" rep_origin complement(4677..5265) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5439..6296) /label="AmpR" /note="beta-lactamase" promoter complement(6297..6401) /label="AmpR promoter" promoter 6747..6763 /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.