pRGC-BHR vector (V015749)

Download GeneBank File(.gb)

LOCUS       62056_18825        8792 bp DNA     circular SYN 28-FEB-2021
DEFINITION  Cloning vector pRGC-BHR, complete sequence.
ACCESSION   MW148405
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8792)
  AUTHORS   Mellini M, Lucidi M, Imperi F, Visca P, Leoni L, Rampioni G.
  TITLE     Generation of genetic tools for gauging multiple gene expression at 
            single cell level
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8792)
  AUTHORS   Mellini M, Lucidi M, Imperi F, Visca P, Leoni L, Rampioni G.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2020) Science, University Roma Tre, Viale 
            Guglielmo Marconi 446, Roma 00146, Italia
REFERENCE   3  (bases 1 to 8792)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-OCT-2020) Science, University Roma Tre, Viale Guglielmo Marconi 
            446, Roma 00146, Italia"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..8792
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(528..722)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(791..1861)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     gene            complement(2054..2269)
                     /gene="parG"
                     /label=parG
     CDS             complement(2054..2269)
                     /codon_start=1
                     /transl_table=11
                     /gene="parG"
                     /product="ParG"
                     /label=parG
                     /note="pVS1 partitioning protein"
                     /protein_id="QRZ20922.1"
                     /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT
                     KLKMYAVRQGKTITELLSEYIAQLPE"
     CDS             complement(2293..2919)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             complement(3006..3221)
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /protein_id="QRZ20924.1"
                     /translation="MKPHQDGQDEPFFITEEIEAEMIAAGYVFEPPAHVSTVRLHEILA
                     GLSDAKLAAWPASLAAEETERRRLKR"
     CDS             complement(3218..3904)
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /label=resolvase
                     /note="derived from pVS1"
                     /protein_id="QRZ20925.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"
     CDS             complement(4161..4691)
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     promoter        complement(4880..4908)
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     promoter        complement(4926..5030)
                     /label=AmpR promoter
     primer_bind     5269..5285
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        5295..5313
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             complement(5331..6047)
                     /label=ECFP
                     /note="enhanced CFP"
     regulatory      complement(6054..6065)
                     /label=strong bacterial ribosome binding site
                     /note="strong bacterial ribosome binding site"
                     /regulatory_class="ribosome_binding_site"
     primer_bind     6083..6099
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      6120..6131
                     /label=strong bacterial ribosome binding site
                     /note="strong bacterial ribosome binding site"
                     /regulatory_class="ribosome_binding_site"
     CDS             6138..6851
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     terminator      6874..6968
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     primer_bind     complement(7019..7035)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      7058..7069
                     /label=strong bacterial ribosome binding site
                     /note="strong bacterial ribosome binding site"
                     /regulatory_class="ribosome_binding_site"
     CDS             7076..7783
                     /label=mCherry
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     promoter        complement(7806..7824)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     rep_origin      complement(8016..8604)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"