Basic Vector Information
- Vector Name:
- pJC04
- Length:
- 5486 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Cui J.
pJC04 vector Map
pJC04 vector Sequence
LOCUS V015746 5486 bp DNA circular SYN 10-MAR-2019 DEFINITION Exported. ACCESSION V015746 VERSION V015746 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5486) AUTHORS Cui J. TITLE Direct Submission JOURNAL Submitted (28-JUN-2018) MCB, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 2 (bases 1 to 5486) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (28-JUN-2018) MCB, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" FEATURES Location/Qualifiers source 1..5486 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(100..1047) /label="Rep101" /note="RepA protein needed for replication with the pSC101 origin" rep_origin complement(1095..1317) /direction=LEFT /label="pSC101 ori" /note="low-copy replication origin that requires the Rep101 protein" misc_feature 1844..2328 /label="upstream homology recombination flank" /note="upstream homology recombination flank" CDS 2329..2499 /codon_start=1 /transl_table=11 /product="ferredoxin" /label="ferredoxin" /note="Clo1313_2761" /protein_id="QBI89800.1" /translation="MAYFITDACISCGACESECPVSCISPGDSVYVIDADACIECGACA NVCPVDAPQQK" misc_feature 2500..3040 /label="downstream homology recombination flank" /note="downstream homology recombination flank" regulatory 3045..3575 /label="kanamycin promoter" /note="kanamycin promoter" /regulatory_class="promoter" gene 3576..4337 /gene="htk" /label="htk" CDS 3576..4337 /codon_start=1 /transl_table=11 /gene="htk" /product="highly thermostable kanamycin nucleotidyltransferase" /EC_number="2.7.7.46" /label="htk" /protein_id="QBI89801.1" /translation="MKGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVLSTEGVEFSYEWTTGEWKAEVNFYSEEILLDYASRVEPDWPLTHGRFF SILPIYDPGGYFEKVYQTAKSVEAQKFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQPDLPPGYVQLCQLVMSGQLSDPEK LLESLENFWNGVQEWAERHGYIVDVSKRIPF" CDS 4361..4939 /gene="tdk" /label="Thymidine kinase" /note="Thymidine kinase from Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E). Accession#: B0K7G9" misc_feature 5034..5486 /label="gene target internal homology recombination flank" /note="gene target internal homology recombination flank"
This page is informational only.